SecReT4
Protein ID: 296105658
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00224
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]185578..186543 [+]
Producthypothetical protein
Component typeTrbB
UniProt IDD5T6G6
KEGG IDlpa:lpa_00224
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-84, Aligned region: 27..295
FtsK_SpoIIIE [PF01580], Evalue: 4.1e-09, Aligned region: 120..195
AAA_19 [PF13245], Evalue: 3.4e-06, Aligned region: 140..189
AAA_10 [PF12846], Evalue: 5.7e-06, Aligned region: 150..192
DUF87 [PF01935], Evalue: 5.7e-05, Aligned region: 150..185
AAA_29 [PF13555], Evalue: 6.9e-05, Aligned region: 148..170
Protein Sequence: 321 a.a.     [Download]
>gi|296105658|ref|YP_003617358.1| hypothetical protein lpa_00224 [Legionella pneumophila 2300/99 Alcoy]
MNVDNEPLVTVKDRAKEKLRRELGDLIGNVLNDPKTVEIMCNADGKIWQERLGESMRCIGNITVARAESI
IKTIAGFHGKEVTRFKPMLEGELPLDGSRFAGQLPPVVSGPTFAIRKKAISVFTLDDYVQSEIMTPAQCE
VIQQAVANHRNILVIGGTGSGKTTLVNAIIDEMVKSAPEERIFIIEDTGEIQCTAENCIQYHTTLDVSMT
QLLKTTLRMRPDRILVGEVRGGEALDLLDAWNTGHEGGAATLHANNCIAGLHRLKSLITRNPAAPSEIEP
LIGEAVHCVVHIARTPAGRRIEEIISIHGFDKGRYRIEKLV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|296105497|ref|NC_014125.1|:185578-186543 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAATGTAGATAACGAGCCATTGGTGACAGTCAAAGACCGAGCCAAAGAAAAACTAAGGCGTGAATTAG
GTGATTTGATTGGAAATGTCTTAAATGATCCAAAAACCGTAGAAATCATGTGTAACGCCGATGGCAAAAT
TTGGCAGGAGCGTCTTGGTGAATCGATGCGCTGCATTGGAAATATCACCGTGGCGCGAGCTGAAAGCATT
ATCAAAACCATCGCAGGCTTTCATGGAAAAGAAGTGACTCGATTTAAGCCCATGCTTGAAGGTGAATTGC
CTCTGGATGGTTCGCGCTTTGCGGGCCAACTTCCACCCGTTGTATCCGGACCAACCTTTGCTATCCGCAA
AAAAGCCATATCGGTTTTTACCCTTGATGACTATGTGCAGTCGGAAATTATGACGCCTGCGCAGTGTGAG
GTGATTCAACAAGCAGTAGCAAATCATCGCAATATTTTAGTCATTGGCGGGACAGGTTCAGGTAAAACCA
CTTTAGTGAATGCCATTATTGATGAAATGGTAAAAAGCGCTCCAGAAGAGCGAATTTTTATCATAGAAGA
TACGGGCGAAATCCAGTGTACGGCTGAAAACTGCATTCAATACCACACCACACTCGATGTCAGCATGACT
CAGCTTTTAAAAACCACACTCAGGATGCGCCCTGACAGAATTCTTGTTGGTGAGGTTCGAGGTGGTGAAG
CTTTAGATTTACTGGATGCATGGAATACCGGCCATGAAGGCGGTGCAGCCACTTTGCATGCAAACAACTG
CATTGCAGGCCTTCATCGGTTGAAGTCACTCATCACCCGAAATCCAGCAGCGCCTTCTGAAATCGAACCT
TTAATTGGCGAGGCGGTTCATTGTGTCGTGCATATCGCAAGAACGCCCGCGGGTCGCAGAATTGAAGAAA
TCATATCTATTCATGGCTTTGATAAAGGCCGGTATCGAATCGAAAAACTTGTTTGA
 Primer design