SecReT4
Protein ID: 296105659
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00225
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]186556..186933 [+]
ProductConjugal transfer protein
Component typeTrbC
UniProt IDD5T6G7
KEGG IDlpa:lpa_00225
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.8e-18, Aligned region: 8..104
Protein Sequence: 125 a.a.     [Download]
>gi|296105659|ref|YP_003617359.1| Conjugal transfer protein [Legionella pneumophila 2300/99 Alcoy]
MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLTKIQKSITGPFAFSAAIIGLVAAGAT
LIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAITGKGAEISKPSTEVNAAEHQL
 
Nucleotide Sequence: 378 bp     [Download]
>gi|296105497|ref|NC_014125.1|:186556-186933 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGACTCAGGTAAGCACCTTAAATTATAAAAAAATGTGGATGATGGGATTAGTGGTTCTGTTTTTATTAT
TTATTACCCATCCAGCAATGGCCTCGACTGCTGGCGGTGGTCTTCCTTTTGATTCATGGCTCACCAAAAT
ACAAAAATCCATTACCGGCCCGTTTGCTTTTAGTGCAGCCATCATTGGATTAGTTGCTGCAGGCGCCACG
CTTATTTTTGGCGGCGATATGAATGGTTTTATGCGAACACTTGTCTTTTTTGTATTAGTGCTCTCATTTT
TGGTAGCCGCGCAAAATACCATGACGGCCATTACCGGCAAAGGTGCGGAAATATCTAAACCATCTACAGA
AGTGAATGCAGCGGAGCATCAGTTATGA
 Primer design