SecReT4
Protein ID: 296105660
T4SS name [ID]Trb [52]
Gene symboltrbD
Locus taglpa_00226
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]186930..187229 [+]
ProductConjugal transfer protein trbD
Component typeTrbD
UniProt IDD5T6G8
KEGG IDlpa:lpa_00226
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-27, Aligned region: 1..87
Protein Sequence: 99 a.a.     [Download]
>gi|296105660|ref|YP_003617360.1| Conjugal transfer protein trbD [Legionella pneumophila 2300/99 Alcoy]
MSLRTIPIRKCGNRPNLFLGGDRELVMFSGLLSAILVFAAQDWLAAIAGMVMWFLSLKGLRLMAKSDPFM
RAIYLRQRSYQAYYAPRSTPFRENKRGYQ
 
Nucleotide Sequence: 300 bp     [Download]
>gi|296105497|ref|NC_014125.1|:186930-187229 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAGCCTTCGCACCATCCCTATCCGAAAATGCGGTAACCGCCCTAACTTGTTTTTAGGCGGTGATCGCG
AGCTGGTTATGTTTTCAGGACTGTTGTCAGCCATTTTAGTGTTTGCTGCTCAAGATTGGTTAGCCGCGAT
TGCGGGTATGGTCATGTGGTTTTTATCTCTGAAAGGCCTTCGCTTAATGGCCAAATCAGATCCTTTTATG
CGTGCGATTTATTTAAGGCAACGAAGTTATCAAGCCTATTATGCGCCTCGCTCAACTCCTTTTAGAGAAA
ATAAAAGAGGTTATCAATGA
 Primer design