SecReT4
Protein ID: 296105661
T4SS name [ID]Trb [52]
Gene symboltrbE
Locus taglpa_00228
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]187226..189763 [+]
ProductConjugal transfer protein trbE precursor
Component typeTrbE
UniProt IDD5T6G9
KEGG IDlpa:lpa_00228
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.1e-41, Aligned region: 223..431
AAA_10 [PF12846], Evalue: 7.7e-28, Aligned region: 490..764
Protein Sequence: 845 a.a.     [Download]
>gi|296105661|ref|YP_003617361.1| Conjugal transfer protein trbE precursor [Legionella pneumophila 2300/99 Alcoy]
MIPVITFLLSLTGLIFLSFLFYQTRLNSQTHHLKKHRQQKAGFVDLLNYAALVDDGVIIGKNGSFMAAWL
YSGEDHANSTDKAREMVSFRINQALSAMGSGWMVHVDAIRRAAPSYSERGCSHFPDPISLAVDEERRQLF
ERLGTLYEGYFVITLTWYPPVLAQKRFEALMFDDNQARLSQKAKTHQLIEEFKQSCRNFESRMSSALNLE
RLQSEKIINEQGSTVIQDNFLRHLQFCATGLNHPVNLPKNPIYLDALIGGQELLTGITPKIGKKFIQCVA
IEGFPMESYPGILTALTLLPIEYRWSSRFIFLDAHEAVAHFTKFRKKWKQKVRGFFDQIFHTHSGAIDED
ALNMVEDAQAAIAETNSGLVGQGYFTSVVILMDEDRALVEKAALFIEKNINALGFTARLETINTMDAFMG
SLPGHGVENIRRPLINTMNLADLLPTSNIWTGENKAPCPLFPPLSPPLMHCITSGNAPFRLNLHVRDLGH
GIMFGPTRSGKSTHLGLIALSWRRYKDARIYSFDKGMSMYPTCKATGGEHYTIADKDSKLAFAPLQFLST
SADRAWAMEWIDTILALNGLNTTPAQRNEIGHAVISMHKSGSKTLSEFVMTIQDEQIRETLKQYTIDGLM
GHLLDAESDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLAHPVFKN
KIAEWLDSMAKKNCVVFMATQHLSHAANSGILDTIVESTATKIFLPNLYARDPETRLIYERMGLNPRQID
IIASAQPKRDYYYVSEKGQRLYQLALGPLALAFVGATDPDSIERMKQLEDKYGAEWVSFWLSEKGVDIKS
HGVAA
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|296105497|ref|NC_014125.1|:187226-189763 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGATTCCAGTCATTACCTTTTTGCTTAGTCTTACAGGACTTATTTTTTTAAGTTTCCTGTTTTACCAGA
CGCGCTTAAATAGCCAGACCCATCATTTAAAAAAGCATCGCCAGCAAAAAGCAGGATTTGTTGATTTACT
CAATTATGCCGCCCTGGTCGATGATGGCGTCATTATCGGCAAAAATGGTTCATTTATGGCAGCCTGGCTC
TATAGCGGTGAAGATCATGCCAATAGCACCGATAAAGCACGTGAGATGGTGTCATTTCGAATCAATCAAG
CCTTATCTGCTATGGGCAGTGGTTGGATGGTTCATGTTGATGCCATACGTCGGGCAGCTCCCAGCTATAG
CGAACGAGGATGTTCGCACTTTCCTGATCCCATATCTTTAGCGGTTGATGAAGAAAGAAGACAGCTTTTT
GAGCGTTTAGGCACTTTATATGAAGGTTATTTTGTTATTACTTTGACCTGGTATCCACCTGTATTGGCGC
AAAAACGCTTTGAGGCGTTGATGTTTGATGACAACCAGGCCCGTTTAAGCCAAAAAGCTAAAACGCACCA
GCTTATTGAAGAATTTAAGCAATCTTGTCGTAACTTTGAATCGCGCATGAGTTCTGCACTTAATCTTGAA
AGGCTACAGTCAGAAAAAATCATTAATGAGCAAGGCAGCACTGTAATACAGGATAATTTTTTAAGACACC
TGCAGTTTTGTGCCACTGGATTAAACCACCCAGTCAATTTACCTAAAAATCCAATATACCTTGATGCCTT
AATAGGCGGCCAGGAATTGCTGACCGGAATTACCCCAAAAATTGGGAAAAAATTCATTCAGTGCGTAGCA
ATTGAAGGATTCCCGATGGAATCTTACCCAGGCATTTTAACAGCTCTTACTCTCCTGCCGATTGAATATC
GCTGGAGTTCACGCTTTATCTTTTTGGATGCTCATGAAGCGGTGGCTCACTTCACTAAGTTTCGTAAAAA
GTGGAAACAAAAAGTCAGAGGCTTTTTTGACCAGATTTTTCATACCCACTCAGGTGCAATTGACGAAGAT
GCACTGAATATGGTGGAAGATGCACAAGCAGCGATTGCTGAAACCAACTCAGGCTTGGTGGGGCAAGGCT
ATTTCACATCAGTTGTCATTTTAATGGATGAAGACCGTGCCTTAGTGGAAAAAGCAGCCCTTTTCATTGA
AAAAAACATCAATGCACTTGGATTTACGGCACGACTTGAGACCATTAATACCATGGATGCTTTCATGGGC
AGCCTTCCAGGTCATGGCGTCGAAAATATCAGACGGCCTTTGATTAACACCATGAATTTGGCTGACTTAT
TGCCTACATCCAATATTTGGACGGGTGAAAATAAAGCACCTTGCCCGCTCTTTCCGCCATTATCACCGCC
TTTAATGCATTGCATCACCAGTGGTAACGCGCCGTTTCGTTTGAATCTTCATGTAAGAGACTTAGGGCAT
GGGATTATGTTTGGACCCACGCGCTCTGGAAAATCAACCCATCTTGGCTTAATTGCACTGTCCTGGCGGC
GCTATAAAGACGCGCGCATTTACTCGTTTGATAAAGGCATGTCGATGTATCCGACTTGTAAAGCGACGGG
CGGAGAACATTACACCATTGCGGATAAAGACTCAAAACTTGCCTTTGCGCCCTTACAGTTTTTATCAACC
AGTGCAGACAGGGCTTGGGCGATGGAATGGATTGATACCATTCTTGCTTTAAATGGTTTGAATACCACAC
CGGCTCAGCGTAATGAAATCGGGCATGCCGTTATCAGCATGCATAAAAGCGGCTCGAAAACGCTGTCTGA
ATTTGTGATGACCATTCAGGATGAGCAAATTCGTGAAACATTAAAACAATACACCATTGATGGTTTGATG
GGACATTTATTGGATGCTGAAAGCGATGGTTTAGGTTTGTCTTCTTTTATGACGTTTGAAATTGAGCATT
TAATGGGATTGGGCGAGAAATTTGCACTTCCCGTATTGCTGTATTTATTCAGACGAATTGAAACCTCCCT
GGATGGACGCCCAACTTTGATTTTATTGGATGAAGCATGGTTGATGCTGGCGCATCCTGTCTTTAAAAAC
AAAATTGCCGAGTGGCTGGACTCTATGGCTAAGAAAAATTGTGTGGTATTCATGGCAACCCAGCATTTAT
CCCATGCCGCAAACTCCGGCATTTTAGACACCATCGTTGAATCAACCGCTACCAAAATCTTTTTACCTAA
TCTTTATGCAAGAGATCCTGAAACTCGCTTGATTTATGAACGCATGGGCTTAAATCCACGGCAAATCGAC
ATCATAGCATCAGCGCAACCTAAGCGTGATTACTACTACGTCAGCGAAAAAGGACAACGCCTCTATCAAT
TGGCATTGGGTCCTTTGGCCTTGGCGTTTGTAGGTGCCACCGATCCAGATTCTATTGAGCGTATGAAACA
GCTTGAAGATAAGTATGGTGCTGAGTGGGTCTCTTTCTGGCTTTCAGAAAAAGGAGTTGATATTAAATCA
CACGGAGTTGCAGCATGA
 Primer design