SecReT4
Protein ID: 296105662
T4SS name [ID]Trb [52]
Gene symboltrbF
Locus taglpa_00230
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]189760..190503 [+]
ProductConjugal transfer protein trbF
Component typeTrbF
UniProt IDD5T6H0
KEGG IDlpa:lpa_00230
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.1e-44, Aligned region: 28..239
Protein Sequence: 247 a.a.     [Download]
>gi|296105662|ref|YP_003617362.1| Conjugal transfer protein trbF [Legionella pneumophila 2300/99 Alcoy]
MNKLKQWLNRLNTECKKSNLTDNPYLNAKRAWNVHTAGLMKSLQVWQLVGLGSLLITLAAVGGLISIGSQ
SKFIPLVFQQDANGNTLSITRADRISQPSIDDYRATAAHFIENIRMVSADVELQKKAVFQVYSYLNQNDA
ALAKVQEFYNDKQHSNPFERAAHEIVNVEIRSVLQESDKTWQVDWVETVRNRDGSIKEKPYVMKAMLTMY
QDETLNDISSESILKNPHLIFIRDFNWSYDLKHGESR
 
Nucleotide Sequence: 744 bp     [Download]
>gi|296105497|ref|NC_014125.1|:189760-190503 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAACAAACTGAAGCAATGGTTAAATCGTTTAAATACGGAATGTAAAAAGTCGAATTTAACCGATAATC
CTTACCTTAATGCCAAACGAGCCTGGAACGTTCACACTGCAGGACTTATGAAATCACTACAGGTTTGGCA
GTTGGTAGGTTTGGGAAGTCTTTTAATAACCCTGGCAGCAGTAGGTGGTCTTATTTCGATTGGCAGCCAA
TCTAAATTTATTCCCTTAGTCTTTCAACAGGATGCGAATGGCAATACGCTTTCAATTACACGCGCTGATA
GGATAAGCCAGCCTAGCATTGATGATTATCGCGCAACGGCCGCGCATTTCATTGAAAACATTCGCATGGT
GAGTGCCGATGTCGAATTGCAGAAAAAGGCAGTCTTTCAAGTTTATTCTTATTTAAACCAAAATGATGCA
GCGTTAGCCAAAGTTCAAGAGTTTTATAACGATAAGCAACATTCCAATCCTTTTGAACGTGCCGCGCATG
AAATCGTTAACGTTGAAATTCGCTCAGTACTGCAGGAATCCGATAAAACCTGGCAAGTCGATTGGGTGGA
AACGGTGCGAAACCGAGACGGGAGTATTAAAGAAAAACCATACGTGATGAAAGCCATGCTGACCATGTAT
CAGGATGAGACGCTCAATGATATTTCCAGTGAGTCCATTTTAAAAAATCCTCACTTGATTTTTATCCGCG
ATTTTAACTGGTCTTATGACTTAAAGCATGGGGAGTCACGATGA
 Primer design