SecReT4
Protein ID: 296105663
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00231
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]190500..191375 [+]
Producttype IV secretion system protein VirB9
Component typeTrbG
UniProt IDD5T6H1
KEGG IDlpa:lpa_00231
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.7e-57, Aligned region: 68..290
Protein Sequence: 291 a.a.     [Download]
>gi|296105663|ref|YP_003617363.1| type IV secretion system protein VirB9 [Legionella pneumophila 2300/99 Alcoy]
MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALKIAGKWQKGDKTSKPFQSSDGSVSFV
YGSGQISIVCAPLQVCDIALQPGELFNDMNVGDPRFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTT
DRRTYHFRLKSERFEFMPYISFIYPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARF
KPVRVYNDGVKTIIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSG
SAQEKITITRC
 
Nucleotide Sequence: 876 bp     [Download]
>gi|296105497|ref|NC_014125.1|:190500-191375 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAAATTATTCTCTCAATCGGTTTGTTGTTACCGTTTTCCATTTTTGCTCAAGATAATGATGAAC
TGAGCAACCGCTATTTTTCCCAAAGCATGCCTAAACTGACTTATCAGGAAACGCAAGCGTTAAAAATAGC
TGGAAAATGGCAAAAAGGTGATAAAACCAGTAAGCCGTTTCAATCTTCAGATGGCTCGGTCAGTTTTGTC
TATGGCTCTGGTCAAATCAGCATCGTTTGCGCGCCTTTGCAAGTTTGCGATATTGCTTTGCAACCAGGCG
AGCTATTTAACGACATGAATGTCGGTGATCCGCGCTTTATCGTTGAACCTTCCATTACAGGTTCAGGACG
AAACCAGCAAATTCATTTAATCATCAAACCCAAAGACGTTGGTCTGGATTCCTCGCTGGTCGTCACCACC
GATAGAAGAACCTATCATTTCCGTTTGAAATCAGAGCGCTTTGAGTTTATGCCGTATATTTCTTTTATCT
ATCCTGATGAGGCCAAAGAAAAATGGCGTTTAATTCAGAAAATTCAGGCAGAAAACAGAAAAGCCAATAC
CTTCCCAGAAACCAATGAGTACTTAGGCAACCTTAACTTTAATTATCGAATACAAGGAAATGCACGCTTC
AAACCGGTTCGGGTTTATAACGATGGCGTTAAAACCATCATTGAAATGCCCAAGGCTATGGCTCAATTTG
AAGCGCCTGCCCTTTTAGTCTTGAGAAAGCACGGTTTCTTGCAAAAATCAAAACCCGTGATGGTTAATTA
TCGCCTGCAAGGCTGTCGTTACATCGTGGATAGCGTTTTTGATAAGGCCATGCTCGTTGTTGGAAGCGGG
AGCGCTCAGGAAAAAATCACCATTACGAGGTGCTAA
 Primer design