SecReT4
Protein ID: 296105664
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00233
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]191378..191788 [+]
Producthypothetical protein
Component typeTrbH
UniProt IDD5T6H2
KEGG IDlpa:lpa_00233
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.2e-38, Aligned region: 28..136
Protein Sequence: 136 a.a.     [Download]
>gi|296105664|ref|YP_003617364.1| hypothetical protein lpa_00233 [Legionella pneumophila 2300/99 Alcoy]
MKKLSILLLTVLLSSCASMRYGNFTNASTAKDAYLAKDAVSQLTRVYPPAQNTFCFRQKICDGFGRHLIQ
AMRQKGYGVIENVHPRQKANFFYVVDEAEPGRMYRVSLYIGPQILSRAYANTRGKLAPISPWSHKE
 
Nucleotide Sequence: 411 bp     [Download]
>gi|296105497|ref|NC_014125.1|:191378-191788 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAATTAAGCATTTTATTGCTGACTGTATTGCTATCGAGCTGTGCGAGTATGCGTTATGGCAATT
TTACCAATGCTTCAACAGCTAAAGATGCCTATTTGGCGAAAGATGCCGTTTCGCAATTAACGCGAGTCTA
TCCGCCTGCGCAAAACACCTTCTGCTTTCGTCAAAAAATATGCGACGGCTTTGGTCGTCATTTGATTCAA
GCCATGCGCCAAAAAGGATATGGCGTGATTGAAAACGTGCACCCAAGACAAAAAGCCAATTTTTTCTATG
TGGTTGATGAAGCCGAACCTGGTCGGATGTATCGCGTCAGTCTATACATTGGCCCGCAAATATTAAGTCG
AGCCTATGCAAACACCCGTGGAAAACTTGCGCCAATTAGCCCATGGTCACACAAGGAATGA
 Primer design