SecReT4
Protein ID: 296105665
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00234
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]191794..193035 [+]
Producttype IV secretion system protein VirB10
Component typeTrbI
UniProt IDD5T6H3
KEGG IDlpa:lpa_00234
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3e-60, Aligned region: 218..404
Protein Sequence: 413 a.a.     [Download]
>gi|296105665|ref|YP_003617365.1| type IV secretion system protein VirB10 [Legionella pneumophila 2300/99 Alcoy]
MHKNNDYLSPDSSPQKLQTTGVKRVNNMPLFIAIGVLTVFVLLIAFVALKRANAQNLVTEPAKLTTAKKN
TMSLAYEVIGNRKPETNQPVVNAPEPTLPVPPPQNTHENQSLDAQSVPDAEMERIRQEKTQAFEEAVNAK
TSIMVDNARLNAREITNASTINHDTTTEVNVVLNFKEQLNKLQARQNARPMPQTLGGEEGESRWHLNSRL
ESPNSRFELRAGSVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVIGLYSSDVSFGQDS
VLVAWQRLVFPDGKALDIGSMPGADNAGYAGFRDQVDHHYARIYGSALLMSGIVAGITYSQNTNQTNPYG
YNQPTAGSVLSQALGQQLGEVTSQMVSKNLNISPTINIRPGYRFNIIVIKDLTFKSPYRQFAY
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|296105497|ref|NC_014125.1|:191794-193035 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGCATAAAAATAACGATTATTTATCACCTGATTCTTCACCGCAAAAGCTTCAAACCACGGGAGTTAAGC
GTGTAAATAACATGCCTTTATTCATAGCCATTGGAGTTTTAACCGTTTTTGTCCTTCTGATAGCCTTCGT
AGCACTTAAAAGAGCAAATGCACAAAATCTGGTTACAGAACCTGCGAAGCTTACAACAGCGAAGAAAAAT
ACCATGAGCTTGGCGTATGAGGTTATTGGCAATCGCAAGCCAGAAACTAATCAACCGGTAGTGAATGCTC
CAGAGCCTACACTGCCCGTTCCTCCGCCACAAAATACCCATGAAAACCAATCCCTGGACGCTCAAAGTGT
ACCAGACGCTGAAATGGAGCGCATTCGACAAGAAAAAACACAAGCTTTTGAGGAAGCAGTCAACGCAAAA
ACATCCATCATGGTTGATAACGCACGATTAAATGCCAGAGAAATTACCAATGCATCAACGATAAATCATG
ACACGACAACCGAGGTGAATGTCGTGCTTAACTTCAAAGAACAACTTAATAAGCTACAAGCACGGCAAAA
CGCCAGGCCCATGCCGCAAACGTTAGGTGGCGAGGAAGGTGAAAGCCGATGGCATTTAAACTCAAGGCTT
GAAAGCCCAAACAGTCGTTTCGAATTAAGGGCAGGCAGCGTTATTCCAGGGGTGATGGTGAGTGGCATTT
CCTCCGAATTGCCAGGACAAATTATCGGTCAGGTTTCACAAAACGTTTACGATACGGCTACCGGTAAATA
TCTATTAATCCCGCAGGGCACTAAGGTTATTGGACTTTATTCCAGTGATGTGAGCTTTGGGCAAGATTCC
GTTTTAGTAGCTTGGCAGCGCTTAGTGTTTCCAGATGGTAAAGCATTAGATATTGGTTCTATGCCAGGAG
CTGACAATGCGGGGTATGCTGGATTTCGCGATCAGGTGGATCATCACTATGCAAGAATTTATGGCTCAGC
CCTTCTCATGTCTGGCATCGTCGCAGGGATTACCTACAGTCAGAATACAAACCAGACCAACCCCTATGGA
TACAATCAACCGACAGCGGGTAGTGTCTTAAGTCAGGCGTTGGGGCAACAGCTGGGTGAAGTGACATCAC
AGATGGTTTCAAAAAATTTAAATATCTCACCGACCATAAACATTCGGCCTGGTTACCGTTTCAATATTAT
TGTCATTAAAGATTTAACTTTTAAAAGCCCTTATCGGCAATTTGCTTATTAA
 Primer design