SecReT4
Protein ID: 296105666
T4SS name [ID]Trb [52]
Gene symboltrbJ
Locus taglpa_00235
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]193049..193789 [+]
ProductConjugal transfer protein trbJ precursor
Component typeTrbJ
UniProt IDD5T6H4
KEGG IDlpa:lpa_00235
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|296105666|ref|YP_003617366.1| Conjugal transfer protein trbJ precursor [Legionella pneumophila 2300/99 Alcoy]
MKLRLMLIFLWSANAFSNGAPVFDFANWLENGKIIVNQVHQYKTQIDQYNNQLQQYQNMLDNTKSLTSFQ
WDNANGVINNLLDATNTIDYYKQEAGSLQGYLDRFQTEEYYQKSPCFNGDRRCTPAEMRKINQNKMAASV
AQKRANDAMLKGIDKQQQNLKSDSEKLRMLQTQAQGAQGQKQALQAASQLASNQSHQLLQIRGLLLAQQN
AQATKDAAALNKEAIQTAGDERFRSGTYHKSSGKKW
 
Nucleotide Sequence: 741 bp     [Download]
>gi|296105497|ref|NC_014125.1|:193049-193789 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAACTCAGACTCATGCTTATTTTTTTATGGAGTGCGAACGCTTTTTCAAATGGTGCGCCGGTGTTTG
ACTTTGCAAACTGGCTTGAAAATGGAAAAATCATAGTGAATCAGGTGCACCAGTACAAAACTCAGATTGA
TCAATATAACAATCAACTTCAGCAATACCAAAACATGCTGGATAACACCAAATCGCTCACTTCGTTTCAA
TGGGATAATGCCAATGGTGTTATTAATAATCTGCTTGATGCAACCAATACGATTGATTATTACAAGCAGG
AAGCGGGTAGCCTGCAGGGTTATCTCGATCGTTTTCAAACCGAAGAATACTATCAAAAATCACCCTGTTT
TAATGGCGATAGAAGATGCACGCCAGCGGAAATGAGAAAAATAAATCAAAATAAAATGGCCGCATCTGTT
GCCCAAAAGCGTGCAAATGACGCGATGCTCAAAGGCATTGATAAGCAACAGCAGAATTTAAAAAGCGATT
CAGAAAAACTGCGCATGTTGCAAACCCAGGCGCAAGGTGCCCAAGGCCAAAAACAAGCACTTCAAGCCGC
CTCCCAACTCGCCAGCAATCAATCCCATCAATTACTGCAAATCAGAGGATTGTTACTGGCCCAACAAAAC
GCTCAAGCAACAAAAGATGCTGCAGCTTTGAATAAAGAAGCCATCCAAACGGCCGGTGATGAACGTTTTC
GCTCAGGAACGTACCATAAAAGTTCCGGTAAAAAGTGGTAA
 Primer design