SecReT4
Protein ID: 296105668
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00238
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]194036..195451 [+]
Producthypothetical protein
Component typeTrbL
UniProt IDD5T6H6
KEGG IDlpa:lpa_00238
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-34, Aligned region: 64..278
Protein Sequence: 471 a.a.     [Download]
>gi|296105668|ref|YP_003617368.1| hypothetical protein lpa_00238 [Legionella pneumophila 2300/99 Alcoy]
MKKKTITYLAVFLLIGFSVNCHAHNSSIDSRDLLDNILYRFSATASMWSQTILSYARYLFWSLATISMVW
TYGLMALRKADIQEFMAETVRFLVVVGFFYWLLDNGPAIATAIMDSMRKLAANAAGIDAHISPSDIVDVG
FDIVSKAIDNSSIWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILTYAGVILLGFGGGRWTQDIA
IQYYKTMLGTALQAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVAILLLVLINKIPPVLSGIVS
GGGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGGLSALHAAFKAASQSVGAGDSGSFSGGNSG
SKLGGLAQAMGQASKFAGSFSSHLASGAFDVASEKLGSMKDSFSAKTAETTGGKIADAIQQRASSNAHSV
TSNKTPATDNVTSMGAPEGSFSSGSGEYNQESGGADEVSQFVNQKASGESL
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|296105497|ref|NC_014125.1|:194036-195451 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAAAAGACAATTACTTATTTAGCTGTATTCTTGTTAATCGGTTTTTCAGTAAATTGTCATGCAC
ATAATAGCAGCATAGACAGCCGAGATTTGCTGGATAATATTTTGTACCGTTTTTCTGCTACCGCTTCGAT
GTGGAGTCAAACAATCCTAAGCTATGCTCGTTATCTTTTTTGGTCTTTAGCCACAATCAGCATGGTATGG
ACTTATGGCTTAATGGCGCTTCGTAAAGCCGATATACAAGAATTTATGGCGGAAACCGTGCGGTTTTTAG
TGGTTGTCGGTTTTTTCTACTGGCTTTTAGACAATGGACCTGCCATTGCTACGGCCATCATGGACTCCAT
GCGGAAGCTCGCGGCCAATGCCGCTGGAATTGATGCACATATATCTCCATCCGATATCGTCGATGTGGGC
TTTGATATTGTTTCAAAAGCGATTGATAACTCATCCATCTGGTCTCCTGCTGCAACAACGGTTGGCTTGA
TTGTCGCAGGCGTTATCTTAGTTGTTCTGGCGTTGGTCAGCATCAATATGCTCATCATCTTAATCACCGC
CTGGATATTAACCTATGCCGGCGTCATTTTATTAGGCTTTGGTGGTGGTCGCTGGACTCAAGATATCGCC
ATTCAATATTACAAAACGATGCTTGGGACGGCTCTTCAGGCATTTTCGATGATTTTGATTATCGGCATCG
GCAAGTCCTTTGTGGATCAATACTATGCAGCCATGTCAAATGACATTCTTCTTAAGGAAATGTTCATTAT
GCTGGTTGTCGCAATTCTTTTGCTGGTTCTTATCAATAAAATCCCACCTGTTTTATCTGGCATTGTATCG
GGCGGGGGTCCAAGCGGCGGTGGCAATGGGATTGGGTTAGGCGGCGCTTTAGGTGCAGCAGGTATTGCAG
GGACTGCATTAGCAGGCGCTGCGGGTGCCGCGAGCGCTCACAGTGCAGGCGGTCTTTCAGCATTGCATGC
CGCGTTCAAAGCAGCTTCTCAAAGTGTTGGAGCGGGTGATAGCGGCTCTTTTTCTGGTGGCAATTCGGGT
TCAAAGCTTGGAGGGTTGGCTCAAGCCATGGGACAGGCTTCCAAGTTTGCCGGTTCATTTAGTTCGCATC
TGGCTTCTGGGGCGTTTGATGTCGCAAGCGAAAAACTAGGTAGTATGAAAGACTCATTTTCTGCAAAAAC
CGCTGAAACGACAGGAGGAAAAATTGCAGATGCCATTCAACAACGCGCCTCATCCAATGCTCATTCAGTA
ACCAGCAATAAGACCCCCGCTACTGATAACGTGACCTCAATGGGGGCACCTGAAGGCAGTTTCAGTTCGG
GAAGTGGCGAATATAATCAAGAATCAGGCGGTGCAGATGAAGTCAGTCAGTTTGTCAATCAAAAAGCATC
TGGAGAAAGCCTGTGA
 Primer design