SecReT4
Protein ID: 296105669
T4SS name [ID]Trb [52]
Gene symbol-
Locus taglpa_00239
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]195448..197337 [+]
Producthypothetical protein
Component typeTraG
UniProt IDD5T6H7
KEGG IDlpa:lpa_00239
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.7e-135, Aligned region: 122..609
TraG-D_C [PF12696], Evalue: 6.3e-30, Aligned region: 439..563
TrwB_AAD_bind [PF10412], Evalue: 1.9e-26, Aligned region: 153..563
Protein Sequence: 629 a.a.     [Download]
>gi|296105669|ref|YP_003617369.1| hypothetical protein lpa_00239 [Legionella pneumophila 2300/99 Alcoy]
MSMSKPNKSIGPQVRKKRVEKTNKQIVFLVVLALFVSMQIGTQFVAYKLHYHQSLGFSVAHIYLPWQLLW
WNLQYHSIYPDYFNAAFGLVAMSGSLFLMIILFVSKQLTQENVSEYLHGSARWANQDDLKDAGLIGNEEG
VYVGAVENEKGDIHYLRHNGPEHILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKH
ANNKVIRFEPATLKGSARWNPLDEIRVGTEYEVGDVQNLATLVVDPDGKGLETHWQKTSQALLVGFILHA
IYKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHIDGKTHPVISASARDMIDRPEEEAGSVLSTL
KSYLALYRDPVVAHNVSASDFCIKDLMHHNNPVSLYIVTQPNDKARLQPLVRVMLNMVVRLLADRMEFER
VDDGKGNRFVRTKRNYKHRLLCMIDEFPSLGKLDILQESLAFVAGYGLKFYLICQDINQLKSRERGYGPD
ETITSNCHIQNAYPPNRIETAEHLSKLTGQTTIVKEHITTSGKRVSTFLNQISKTKQEVSRPLLTIDECQ
RMPGPKKDANGLITEAGDMVVYVAGFPAIYGKQPLYFKDPVFIARASVESPEQSDILRTRLSEDEEIRL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|296105497|ref|NC_014125.1|:195448-197337 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
GTGAGCATGAGCAAACCCAATAAATCCATTGGCCCACAGGTAAGAAAAAAGCGCGTTGAAAAGACGAATA
AACAAATCGTTTTTTTAGTTGTGCTCGCGCTTTTCGTCAGTATGCAGATTGGTACGCAATTCGTGGCTTA
TAAACTTCATTACCACCAAAGCTTAGGATTTTCAGTGGCGCATATTTATCTGCCATGGCAGCTACTTTGG
TGGAATCTGCAATACCATTCTATTTACCCGGATTATTTTAACGCGGCCTTTGGCCTGGTGGCGATGAGTG
GCAGTCTTTTTTTAATGATCATTCTTTTTGTCAGTAAGCAACTTACTCAAGAAAACGTCAGTGAATATCT
GCATGGTTCAGCCCGATGGGCTAATCAAGATGATTTAAAAGATGCAGGTTTGATTGGCAACGAGGAAGGC
GTTTATGTGGGTGCCGTTGAAAATGAAAAAGGTGATATTCATTATTTACGCCATAATGGGCCTGAACATA
TTTTAACTTATGCGCCAACGCGCTCCGGTAAAGGTGTAGGACTTGTTATTCCTACTCTTTTATCCTGGAA
ACAGTCTTGTGTGATTACCGATTTAAAAGGCGAACTTTGGGCATTAACTGCTGGCTGGCGGCAAAAACAT
GCCAACAATAAAGTAATACGTTTTGAGCCAGCGACATTAAAAGGTTCAGCGCGTTGGAATCCGTTGGATG
AAATCAGAGTCGGTACGGAATATGAAGTCGGTGATGTGCAAAATCTTGCAACGCTTGTGGTTGATCCAGA
CGGTAAAGGACTCGAAACCCATTGGCAAAAAACATCACAAGCGCTTTTAGTCGGTTTTATCCTCCATGCA
ATTTACAAGCTAAAAAATCAGGGAGAGCCAGCCACATTTCCCAACATTGACAGGATGCTGGTAGATCCCA
ATACCAATATTGCCGATTTATTGATTGAAATGACCCAATACCCACATATTGATGGCAAAACACATCCTGT
GATCAGCGCATCAGCCCGCGATATGATCGACAGGCCCGAAGAAGAAGCAGGCTCTGTATTATCGACTTTA
AAATCGTATCTGGCCTTATACCGAGATCCAGTCGTGGCGCACAATGTTTCTGCCTCTGATTTCTGTATTA
AGGATTTGATGCATCATAATAATCCTGTGAGTCTTTATATCGTCACCCAACCCAATGATAAAGCACGATT
GCAACCATTGGTTCGCGTCATGCTGAATATGGTTGTCCGGCTTTTGGCAGATAGAATGGAATTTGAGCGA
GTTGATGATGGGAAAGGAAACCGATTTGTAAGAACGAAAAGAAACTATAAGCACCGTTTGCTGTGCATGA
TTGATGAATTTCCAAGTCTTGGCAAACTGGATATTTTGCAAGAGTCCTTAGCATTTGTTGCAGGTTATGG
TTTAAAGTTTTATTTAATCTGTCAGGACATTAACCAGCTTAAAAGCCGCGAAAGAGGCTATGGGCCGGAT
GAAACGATCACTTCTAACTGCCATATTCAAAATGCTTATCCTCCCAACCGGATTGAAACGGCTGAACATC
TATCGAAATTAACCGGCCAAACCACTATTGTCAAAGAGCACATCACCACCAGCGGCAAGCGTGTTTCAAC
CTTTTTAAATCAGATTTCTAAAACAAAACAAGAAGTTTCTAGGCCGCTTTTAACCATTGACGAATGTCAG
CGTATGCCAGGGCCTAAAAAGGATGCTAATGGCTTAATTACTGAAGCGGGTGATATGGTGGTGTATGTTG
CAGGTTTTCCCGCTATATATGGAAAACAACCGCTTTATTTCAAAGATCCAGTGTTTATCGCCAGAGCTTC
CGTTGAGTCACCTGAGCAATCCGATATCTTACGTACTCGTCTTTCTGAAGATGAGGAAATCAGGCTATGA
 Primer design