SecReT4
Protein ID: 296105670
T4SS name [ID]Trb [52]
Gene symboltraF
Locus taglpa_00240
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]197334..197879 [+]
ProductConjugal transfer protein traF precursor
Component typeTraF
UniProt IDD5T6H8
KEGG IDlpa:lpa_00240
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.6e-34, Aligned region: 27..173
Protein Sequence: 181 a.a.     [Download]
>gi|296105670|ref|YP_003617370.1| Conjugal transfer protein traF precursor [Legionella pneumophila 2300/99 Alcoy]
MKKFMAWVAVVLLGLISLSFLLIIMGFRVNITDSIPVGLYRITNLKNLKNAFVIFCPDDRPAFKQGLDRG
YVEKGLCPGGYGYLMKKVVATSGDKVSVISEGVFVNRQFLPYSKPKLTDGMNYALPQWRAIDYQLKEDEI
LTMTNQSEWSFDARYYGPIRLGQIKGVITPVWVKAKMERKT
 
Nucleotide Sequence: 546 bp     [Download]
>gi|296105497|ref|NC_014125.1|:197334-197879 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAGTTTATGGCCTGGGTTGCTGTTGTTCTTTTAGGCCTTATCAGCCTATCGTTTCTTTTAATTA
TTATGGGCTTTCGAGTCAACATTACGGATTCGATTCCTGTTGGACTTTATCGCATCACCAACTTAAAAAA
TCTTAAAAATGCTTTTGTGATTTTTTGCCCTGATGACAGGCCTGCTTTTAAGCAAGGGTTAGATAGAGGC
TATGTTGAGAAAGGCCTTTGTCCTGGTGGTTATGGGTATTTAATGAAAAAAGTGGTAGCAACCAGCGGTG
ATAAAGTGTCCGTCATTTCTGAAGGCGTGTTTGTTAATCGCCAATTTCTTCCCTATTCAAAACCTAAATT
AACGGATGGGATGAATTATGCACTGCCACAATGGCGCGCCATCGATTATCAACTCAAAGAAGATGAAATT
CTGACCATGACTAACCAAAGTGAATGGTCATTTGATGCTCGTTATTACGGCCCGATTCGTTTAGGGCAAA
TCAAAGGAGTGATCACGCCCGTATGGGTCAAAGCAAAAATGGAGAGAAAGACATGA
 Primer design