SecReT4
Protein ID: 296106084
T4SS name [ID]Trb [53]
Gene symbolvirB11
Locus taglpa_00797
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]614527..615492 [+]
ProductLvhB11
Component typeTrbB
UniProt IDD5T8U6
KEGG IDlpa:lpa_00797
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.9e-85, Aligned region: 26..295
FtsK_SpoIIIE [PF01580], Evalue: 8.1e-09, Aligned region: 138..195
AAA_19 [PF13245], Evalue: 1.4e-06, Aligned region: 141..189
AAA_10 [PF12846], Evalue: 5e-06, Aligned region: 150..189
DUF87 [PF01935], Evalue: 1.7e-05, Aligned region: 150..190
AAA_29 [PF13555], Evalue: 4.2e-05, Aligned region: 148..171
AAA_30 [PF13604], Evalue: 4.8e-05, Aligned region: 134..184
AAA_16 [PF13191], Evalue: 0.0001, Aligned region: 146..176
Protein Sequence: 321 a.a.     [Download]
>gi|296106084|ref|YP_003617784.1| LvhB11 [Legionella pneumophila 2300/99 Alcoy]
MTIDEEQLITVKDRAKEKLRRDLGGLIERALNDPKTVEIMLNADGRLWQERLGETMRCIGSINEVRAESI
IKTVAGFHGKEVTRFKPMLEGELPLDGSRFAGQLPPVVSRPTFAIRKKALSVFTLDEYVRAGIMTDEQNE
IIQQAVSNHRNILVIGGTGSGKTTLVNAIIHEMVKSAPHERIFIIEDTGEIQCSAENCVQYHTTMDVNMT
QLIKTTLRMRPDRILVGEVRGSEALDLLDAWNTGHEGGAATLHANNCLAGLHRLKSLITRNPAAPAEIEP
LIGEAVHCVVHIARTPDGRFVKEIISVEGFKNGQYNIKKLV
 
Nucleotide Sequence: 966 bp     [Download]
>gi|296105497|ref|NC_014125.1|:614527-615492 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGACTATCGATGAAGAACAGCTGATTACGGTTAAAGATCGAGCCAAAGAAAAGTTAAGGCGTGATCTGG
GTGGATTGATTGAACGGGCTTTAAACGATCCAAAAACCGTTGAAATCATGCTCAATGCGGATGGCAGGCT
TTGGCAGGAACGTCTTGGGGAAACAATGCGTTGCATTGGAAGTATCAATGAGGTGCGTGCCGAAAGCATC
ATCAAAACTGTTGCAGGCTTTCATGGTAAAGAAGTGACCCGATTTAAGCCGATGCTTGAAGGGGAATTAC
CACTGGATGGTTCCCGTTTTGCAGGACAACTGCCACCGGTTGTATCACGCCCTACATTCGCTATTCGTAA
AAAAGCCCTATCCGTTTTTACACTGGATGAATATGTTCGAGCAGGAATTATGACGGATGAGCAAAACGAG
ATAATTCAACAAGCGGTTTCGAACCACCGGAACATTTTAGTGATTGGCGGCACAGGTTCAGGCAAAACAA
CATTAGTGAACGCCATTATTCATGAAATGGTAAAAAGCGCACCACATGAGCGCATTTTTATCATAGAGGA
TACCGGCGAAATCCAGTGTTCAGCTGAAAACTGCGTTCAATACCATACCACCATGGATGTCAACATGACC
CAACTTATAAAAACCACACTCAGAATGCGCCCTGACCGAATCCTTGTCGGTGAGGTTCGAGGCAGTGAAG
CTTTAGATTTATTGGATGCCTGGAATACCGGCCACGAAGGAGGAGCGGCTACCTTACATGCGAATAACTG
TCTTGCAGGGCTTCATCGTTTGAAATCATTGATTACCAGAAATCCGGCAGCACCCGCTGAAATTGAACCT
TTAATTGGCGAGGCAGTTCATTGTGTGGTGCATATTGCAAGAACGCCAGATGGTCGCTTTGTCAAAGAAA
TCATATCTGTCGAGGGTTTTAAAAATGGTCAATACAACATCAAGAAACTTGTTTAA
 Primer design