SecReT4
Protein ID: 296106085
T4SS name [ID]Trb [53]
Gene symbol-
Locus taglpa_00798
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]615504..615881 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDD5T8U7
KEGG IDlpa:lpa_00798
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-18, Aligned region: 6..104
Protein Sequence: 125 a.a.     [Download]
>gi|296106085|ref|YP_003617785.1| hypothetical protein lpa_00798 [Legionella pneumophila 2300/99 Alcoy]
MNQLSSFNHKKIWMMGAVILFLFLMTHPASASTAGGGLPFDSWLTKIQKSITGPFAFSAAIIGLVAAGAT
LIFGGELNGFMRTLVFFVLVLSFLVAAQNTMTAITGKGAEISKPSVEMTAIESQP
 
Nucleotide Sequence: 378 bp     [Download]
>gi|296105497|ref|NC_014125.1|:615504-615881 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAATCAGTTAAGCAGTTTTAATCACAAGAAAATTTGGATGATGGGGGCAGTCATATTATTTCTATTTT
TAATGACTCATCCGGCTAGCGCCTCCACAGCAGGTGGAGGACTTCCATTCGACTCATGGTTAACCAAAAT
CCAGAAGTCCATTACAGGTCCATTTGCCTTTAGTGCGGCGATTATTGGTCTGGTTGCTGCCGGTGCCACA
CTTATTTTTGGTGGTGAATTAAATGGTTTTATGCGAACCCTTGTCTTTTTTGTATTGGTGCTTTCATTCC
TGGTAGCGGCACAAAATACCATGACAGCGATTACTGGCAAAGGGGCGGAAATTTCCAAGCCATCTGTTGA
GATGACAGCAATCGAGTCTCAGCCATGA
 Primer design