SecReT4
Protein ID: 296106086
T4SS name [ID]Trb [53]
Gene symboltrbD
Locus taglpa_00800
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]615956..616177 [+]
ProducttrbD Conjugal transfer protein trbD
Component typeTrbD
UniProt IDD5T8U8
KEGG IDlpa:lpa_00800
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-16, Aligned region: 1..61
Protein Sequence: 73 a.a.     [Download]
>gi|296106086|ref|YP_003617786.1| trbD Conjugal transfer protein trbD [Legionella pneumophila 2300/99 Alcoy]
MFSGLLSAILVFAAQDWLAAIAGIVMWFLSLKGLRLMAKSDPYMRAVYLRQRRYQAYYPARSTPFRENKR
GYQ
 
Nucleotide Sequence: 222 bp     [Download]
>gi|296105497|ref|NC_014125.1|:615956-616177 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGTTTTCAGGATTGCTATCAGCCATTTTGGTATTTGCCGCTCAGGATTGGCTGGCGGCGATTGCTGGTA
TCGTCATGTGGTTTTTATCTCTGAAAGGACTTCGCTTAATGGCGAAATCTGATCCCTATATGAGAGCGGT
TTATCTGAGGCAAAGACGTTATCAGGCTTATTATCCGGCTCGTTCAACCCCTTTCAGGGAAAACAAAAGA
GGTTATCAATGA
 Primer design