SecReT4
Protein ID: 296106087
T4SS name [ID]Trb [53]
Gene symbol-
Locus taglpa_00803
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]616174..618699 [+]
Producthypothetical protein
Component typeTrbE
UniProt IDD5T8U9
KEGG IDlpa:lpa_00803
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.5e-43, Aligned region: 211..427
AAA_10 [PF12846], Evalue: 2.5e-25, Aligned region: 486..742
Protein Sequence: 841 a.a.     [Download]
>gi|296106087|ref|YP_003617787.1| hypothetical protein lpa_00803 [Legionella pneumophila 2300/99 Alcoy]
MIELIAFLISTTGLVILGTLFWEIRSKSCGHHVKKHRSHTAGLVDLLNYAAVVDDGVIVGKNGSFMAAWL
YHGEDNANTTDEAREMVSFRINQALSAMGSGWMIHVDAMRRTAPGYSARGYSHFPDPISMAVDEERRQLF
EQLGTLYEGYFVITLTWYPPVLVQKRFVELMFDDSGERLSQKAKTHQLIETFKQSCRNFESRMSSAVHLE
RLGSDDKGDTVMQDNFLRHLQYCVTGINHPVNLPKNPIYLDALIGGQELTPGITPKIGRKFVQCVAIEGF
PMESYPGILTALSQLPIEYRWNSRFIFMDAHEAVAHFTKFRKKWKQKVRGFFDQIFNTNSGIVDEDALSM
VNDAQSAIAETNSGMVGQGYYTSVVVLMDEDRAQVEKAALFIEKNINALGFAARVETINTMDAFMGSLPG
HGVENIRRPLINTMNLADLLPTSSIWTGENKAPCPLFPPLSPPLMHCVTSGNAPFRLNLHVRDLGHGIMF
GPTRSGKSTHLGLLALSWRRYKDARIYSFDKGLSMYPTCKATGGEHYTIADKDSKLAFAPLQFLESKADR
AWAMEWIDTILALNGLDTTPAQRNEIGYAIISMHQSGSKTLSEFVMTIQDEHIRETLKQYTIDGLMGHLL
DAECDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLAHPVFKNKIAE
WLDSMAKKNCAVFMATQHLSHAAKSGILDIIVESTATKIFLPNLYARDPETCVIYERMGLNPRQIDIIAQ
AQPKRDYYYVSEKGQRLYQLALGSMALAFVGATDPDSIARMKQLELKYSDGWVSQWLTEKGIQLEQYGEA
A
 
Nucleotide Sequence: 2526 bp     [Download]
>gi|296105497|ref|NC_014125.1|:616174-618699 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGATTGAATTAATCGCCTTTTTGATTAGTACTACAGGGCTTGTCATTTTGGGTACTTTGTTTTGGGAAA
TTCGAAGTAAAAGCTGTGGGCACCATGTCAAAAAGCATCGAAGCCATACAGCTGGACTGGTTGATTTACT
TAATTATGCGGCGGTTGTAGATGATGGTGTAATTGTCGGAAAAAACGGCTCTTTTATGGCGGCCTGGCTT
TATCATGGCGAAGACAATGCCAATACTACCGATGAGGCGCGTGAGATGGTGTCATTTCGGATCAATCAAG
CCTTATCCGCTATGGGTAGCGGTTGGATGATTCATGTAGATGCCATGAGGCGTACTGCACCTGGTTACAG
TGCACGGGGTTATTCTCACTTTCCTGATCCCATATCAATGGCAGTTGATGAAGAAAGAAGGCAGCTATTT
GAACAGTTGGGAACCTTATATGAAGGATATTTTGTTATCACGTTAACCTGGTATCCGCCTGTATTGGTAC
AAAAACGTTTTGTTGAATTGATGTTTGATGATTCAGGGGAGCGCTTAAGCCAGAAAGCAAAAACGCATCA
ATTGATTGAGACCTTCAAGCAATCTTGCCGCAATTTTGAATCACGCATGAGTTCGGCAGTTCATCTGGAA
AGGCTTGGCTCAGATGATAAAGGCGATACAGTAATGCAGGATAACTTTCTAAGGCACTTACAGTATTGTG
TCACAGGAATTAACCATCCCGTCAATCTGCCTAAAAACCCGATTTATCTTGATGCCTTGATAGGCGGTCA
GGAATTAACGCCAGGCATTACTCCGAAAATTGGTCGGAAGTTTGTTCAGTGCGTCGCGATTGAAGGTTTT
CCCATGGAATCTTACCCTGGAATTTTAACCGCGCTATCGCAACTACCCATTGAATATCGCTGGAACTCCC
GCTTCATATTCATGGATGCGCATGAAGCTGTCGCACATTTCACTAAATTCCGTAAAAAATGGAAGCAAAA
AGTCAGAGGATTTTTTGATCAGATTTTTAATACCAATTCAGGCATTGTCGACGAAGATGCGCTTAGCATG
GTCAATGATGCGCAATCAGCCATTGCTGAAACCAATTCTGGCATGGTAGGGCAAGGTTATTACACTTCGG
TTGTTGTTTTAATGGATGAAGATCGCGCACAAGTTGAAAAAGCAGCGCTGTTTATTGAAAAGAACATCAA
TGCGTTGGGTTTTGCGGCCAGAGTAGAAACCATTAATACCATGGATGCTTTTATGGGCAGCCTGCCAGGC
CATGGCGTTGAAAATATCAGACGACCATTGATTAACACCATGAATCTGGCGGACTTATTGCCAACATCCA
GCATCTGGACAGGTGAGAATAAAGCACCGTGCCCACTGTTCCCACCCTTGTCACCACCTCTGATGCATTG
CGTCACCAGTGGTAATGCACCGTTTCGCCTGAATCTTCATGTCAGAGACTTAGGCCATGGCATTATGTTT
GGTCCAACGCGTTCTGGTAAATCAACTCACCTTGGTTTACTCGCATTGTCTTGGCGTCGGTATAAAGATG
CCCGTATTTATTCATTTGACAAAGGACTATCCATGTATCCAACCTGCAAGGCGACAGGTGGTGAGCATTA
CACCATTGCTGATAAAGACTCAAAGCTTGCCTTTGCGCCCTTGCAGTTTTTAGAGTCCAAGGCAGACAGG
GCTTGGGCTATGGAGTGGATTGATACAATACTGGCATTAAATGGTTTGGATACCACCCCAGCACAGCGTA
ATGAAATCGGCTATGCCATTATCAGCATGCATCAAAGTGGCTCTAAAACCTTATCCGAATTTGTCATGAC
CATTCAGGACGAACACATTCGTGAAACCCTAAAGCAATACACCATCGATGGATTGATGGGGCATTTATTG
GATGCTGAATGTGATGGTTTAGGTCTGTCCTCGTTTATGACCTTTGAAATTGAGCACTTAATGGGATTAG
GCGAAAAATTTGCACTGCCTGTGTTGCTCTATCTGTTTCGACGCATTGAAACCTCACTGGATGGCCGCCC
AACGCTCATCTTACTGGATGAAGCGTGGTTGATGCTCGCGCATCCTGTCTTTAAAAACAAGATTGCTGAA
TGGCTTGATTCCATGGCCAAGAAAAACTGCGCTGTATTTATGGCAACTCAACATCTTTCCCATGCAGCAA
AATCCGGCATTTTAGACATCATTGTTGAATCCACAGCCACCAAAATCTTTTTACCCAATCTATATGCAAG
AGATCCTGAAACCTGCGTGATTTATGAACGCATGGGCTTAAATCCACGTCAGATTGACATCATAGCTCAA
GCCCAACCCAAGCGTGATTACTACTATGTCAGCGAAAAAGGACAACGTCTTTATCAATTAGCATTAGGCT
CTATGGCTTTGGCTTTTGTAGGGGCTACTGATCCCGATTCTATAGCTCGGATGAAACAGCTTGAGTTGAA
GTACAGTGATGGATGGGTATCTCAGTGGCTTACGGAAAAAGGAATCCAATTGGAACAGTACGGAGAAGCA
GCATGA
 Primer design