SecReT4
Protein ID: 296106089
T4SS name [ID]Trb [53]
Gene symbol-
Locus taglpa_00807
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]619436..620311 [+]
Producttype IV secretion system protein VirB9
Component typeTrbG
UniProt IDD5T8V1
KEGG IDlpa:lpa_00807
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-56, Aligned region: 68..290
Protein Sequence: 291 a.a.     [Download]
>gi|296106089|ref|YP_003617789.1| type IV secretion system protein VirB9 [Legionella pneumophila 2300/99 Alcoy]
MKKIMLTFCLLMPLTGFALDNNELATRYFSENDPKLSNQEKQALDIAERWQKGDKTSKPFPSSDGSVSFV
YGSGQIRVVCAPLQVCDIALQAGEQFNDMNVGDPRFIVEPSITGSGAAQQIHLLIKPKDVGLDSSLVVTT
DRRTYHFRLKSDRTEFMPYVSFIYPDEAKAKWQFIQNVQAERRKMDTLPETNEYLGNLNFNYRIQGHARF
KPLRVYNNGVKTIIEMPKTMAQSEAPVLLVLRSRGLFQKSESVMVNYRLQGCRYIVDSVFDRAILVIGSG
SSQEKITITRC
 
Nucleotide Sequence: 876 bp     [Download]
>gi|296105497|ref|NC_014125.1|:619436-620311 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAAATAATGCTCACTTTTTGTTTATTGATGCCATTGACAGGTTTTGCCCTGGATAATAATGAGC
TGGCCACTCGTTATTTTTCCGAAAACGATCCAAAACTGTCAAATCAGGAAAAGCAGGCTTTAGATATTGC
AGAGCGTTGGCAAAAGGGAGACAAAACCAGCAAACCATTTCCATCCTCGGATGGATCAGTCAGTTTTGTT
TATGGCTCAGGGCAAATCAGGGTAGTATGCGCTCCCTTGCAGGTTTGTGATATTGCTTTGCAGGCAGGTG
AGCAGTTTAACGATATGAATGTTGGTGATCCACGCTTCATTGTTGAGCCATCCATTACGGGTTCAGGAGC
TGCGCAACAAATCCACTTATTGATCAAGCCTAAAGATGTTGGACTTGATTCCTCTTTGGTCGTAACTACA
GACAGAAGAACTTATCATTTCAGGTTAAAGTCCGACCGCACTGAGTTTATGCCTTACGTATCTTTCATTT
ATCCCGATGAAGCAAAAGCAAAGTGGCAGTTCATTCAAAATGTTCAGGCCGAAAGAAGAAAAATGGATAC
GTTACCAGAAACCAACGAATACCTTGGCAACCTGAATTTCAACTACCGAATTCAGGGCCATGCACGATTT
AAGCCGCTTCGGGTTTACAACAATGGCGTTAAGACCATTATTGAGATGCCGAAAACGATGGCACAAAGTG
AAGCCCCTGTTTTATTGGTTTTAAGAAGCCGTGGTTTGTTTCAAAAATCAGAGTCCGTCATGGTGAATTA
TCGTCTGCAAGGTTGTCGTTACATCGTCGATAGCGTTTTTGATAGGGCAATATTGGTTATCGGAAGTGGA
AGCTCTCAAGAAAAAATTACCATTACGAGGTGCTAA
 Primer design