SecReT4
Protein ID: 296106090
T4SS name [ID]Trb [53]
Gene symbol-
Locus taglpa_00808
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]620314..620724 [+]
Producthypothetical protein
Component typeTrbH
UniProt IDD5T8V2
KEGG IDlpa:lpa_00808
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.9e-38, Aligned region: 28..136
Protein Sequence: 136 a.a.     [Download]
>gi|296106090|ref|YP_003617790.1| hypothetical protein lpa_00808 [Legionella pneumophila 2300/99 Alcoy]
MKELSVLLFALLLSSCASQRYGNFTQVSQGRDVYLAQDAASQLTRVYPPAQNTFCISQKVRDAFGISLIH
EMRKKGYGVIENNCPKQKANFFYVVDEIKATNLYRVSLFIGSQTFSRIYAKTGGKIPPVSAWTHKE
 
Nucleotide Sequence: 411 bp     [Download]
>gi|296105497|ref|NC_014125.1|:620314-620724 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAGGAACTAAGTGTTTTATTGTTTGCTCTATTGCTATCAAGCTGTGCAAGTCAGCGTTATGGGAATT
TTACTCAAGTATCTCAAGGCCGAGACGTTTATTTGGCACAAGACGCGGCATCCCAATTAACACGTGTCTA
TCCACCTGCTCAAAATACGTTTTGCATCAGTCAAAAGGTAAGGGATGCTTTTGGCATCAGCCTGATTCAT
GAAATGCGAAAAAAAGGTTATGGCGTGATTGAAAACAATTGCCCCAAACAAAAGGCCAATTTTTTCTATG
TTGTCGATGAGATTAAAGCAACCAACCTTTACCGAGTCAGCCTTTTTATTGGCTCACAGACCTTCAGCAG
AATTTATGCCAAAACCGGTGGAAAAATTCCCCCAGTTAGCGCATGGACTCATAAGGAGTGA
 Primer design