SecReT4
Protein ID: 296106091
T4SS name [ID]Trb [53]
Gene symboltrbI
Locus taglpa_00810
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]620730..621980 [+]
ProducttrbI Conjugal transfer protein trbI
Component typeTrbI
UniProt IDD5T8V3
KEGG IDlpa:lpa_00810
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-57, Aligned region: 220..407
Protein Sequence: 416 a.a.     [Download]
>gi|296106091|ref|YP_003617791.1| trbI Conjugal transfer protein trbI [Legionella pneumophila 2300/99 Alcoy]
MNQNNDFLSKDYSPQKLQTAGVKRVNNVPLIIVIGILTVFVVLIAFVANKRANAQNQSPEIVKIKSQKKN
TMSLAYEVVGNHKVPVVAPQTETITIKQEASLPILEQQDLPQKQETLDQNVTDAEIERIRQEKTQEFEEA
VKAKTSIMVDNVRLNNRASVRTSMSGNDVTFNVDPSTAFKEQLMLVQGMHNKPMPQTLGGEENEMRWHLN
SRLESPNSRYELRAGGVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVFGIYSSDVSFG
QNSVLVAWQRLVFPDGKALDIGSMPGADSAGFAGFRDQVDHHYARIYGSALLMSGIVAGITYSQNSNQPN
QFGYSQPTAGSVLSQALGQQLGEVTSQLVSKNLNVSPTINVRPGYRFNIIVVKDLTFKQLYRQFAY
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|296105497|ref|NC_014125.1|:620730-621980 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAATCAAAACAACGATTTTTTATCAAAAGACTACTCACCGCAAAAACTCCAGACAGCCGGTGTGAAGC
GGGTGAATAACGTACCATTAATCATTGTCATTGGTATTTTAACTGTGTTTGTGGTGTTGATAGCTTTTGT
TGCCAATAAACGGGCAAATGCACAGAACCAATCTCCCGAAATAGTAAAGATTAAAAGTCAGAAAAAAAAC
ACCATGAGTCTGGCTTATGAAGTGGTAGGAAACCACAAAGTACCAGTCGTAGCTCCGCAAACTGAAACGA
TCACAATCAAGCAGGAGGCTTCCCTACCCATACTTGAGCAACAAGACTTGCCTCAAAAACAAGAGACGTT
GGATCAAAATGTGACTGATGCTGAAATAGAACGCATTCGCCAGGAAAAAACACAAGAATTTGAAGAGGCG
GTCAAAGCAAAAACATCCATTATGGTGGATAACGTACGGCTGAATAACAGAGCAAGTGTAAGGACATCCA
TGAGCGGGAATGACGTGACATTCAATGTTGACCCATCTACGGCCTTTAAAGAGCAACTCATGTTGGTACA
AGGGATGCACAACAAACCCATGCCGCAAACCTTAGGTGGTGAAGAAAATGAAATGCGTTGGCATTTAAAC
TCAAGACTTGAAAGTCCAAACAGCCGATATGAACTCAGAGCGGGTGGGGTGATTCCAGGAGTAATGGTCA
GTGGCATCTCCTCTGAATTACCAGGGCAAATCATCGGTCAGGTATCACAAAACGTCTATGACACCGCAAC
GGGTAAATACCTTCTCATTCCTCAAGGAACCAAAGTATTTGGCATTTATTCCAGTGATGTGAGCTTTGGC
CAGAATTCCGTATTAGTGGCTTGGCAGAGACTGGTATTTCCTGATGGCAAGGCATTGGATATTGGCTCCA
TGCCAGGCGCTGATAGTGCGGGATTCGCCGGATTTCGTGATCAAGTGGATCATCATTATGCAAGAATTTA
TGGCTCAGCGCTTTTAATGTCTGGCATTGTTGCAGGTATTACCTACAGCCAGAATAGTAATCAGCCTAAC
CAGTTCGGTTACAGCCAACCCACAGCGGGTTCTGTCTTGAGTCAGGCATTAGGACAACAGTTAGGTGAGG
TGACATCACAACTGGTTTCAAAAAATTTGAACGTATCCCCGACCATTAATGTCCGTCCGGGTTACCGTTT
CAACATCATTGTAGTGAAAGATTTAACTTTTAAACAACTTTATAGACAGTTTGCTTATTGA
 Primer design