SecReT4
Protein ID: 296106092
T4SS name [ID]Trb [53]
Gene symboltrbJ
Locus taglpa_00811
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]621996..622736 [+]
ProductConjugal transfer protein trbJ precursor
Component typeTrbJ
UniProt IDD5T8V4
KEGG IDlpa:lpa_00811
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|296106092|ref|YP_003617792.1| Conjugal transfer protein trbJ precursor [Legionella pneumophila 2300/99 Alcoy]
MKFRIMLIYLWTLHVFASGAPVFDFANWIENGKIILNQVSQYKTQIDQYNNQLQQYQNMLENTKSLTSFQ
WDNANSVINNLLESTNTIDYYKQEAGSLQGYLDRFQSQEYYQKTPCFNGNGHCSPEELRKIKQSRLSTSV
AEKRANDAMLKGIDKQQQSLKDDSEKLRVLQSQAQSAVGQKQALQAASQLASNQSHQLLQIRGLLLAQQN
AQAVKDAANANKEAIQAAGDEQFRAGTYHKSSGKKW
 
Nucleotide Sequence: 741 bp     [Download]
>gi|296105497|ref|NC_014125.1|:621996-622736 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAATTTAGAATCATGCTTATTTATTTATGGACACTACATGTTTTCGCCAGCGGTGCGCCCGTATTTG
ATTTTGCCAATTGGATTGAAAATGGAAAAATCATACTGAATCAGGTGAGTCAGTATAAAACTCAGATCGA
TCAATACAACAATCAGCTGCAGCAATACCAAAATATGTTAGAGAACACTAAGTCGCTCACTTCCTTCCAG
TGGGATAATGCCAACTCTGTCATTAATAATCTGCTTGAATCGACTAATACAATTGATTATTACAAGCAGG
AAGCAGGCAGCCTTCAAGGTTATCTGGACCGATTTCAGAGCCAGGAATACTATCAGAAAACTCCTTGTTT
TAATGGTAATGGTCATTGCTCACCCGAAGAACTCAGGAAAATCAAACAAAGTAGACTCTCAACTTCTGTT
GCCGAAAAGCGTGCTAATGATGCCATGCTCAAAGGGATTGATAAGCAACAACAGAGCTTGAAAGATGACT
CAGAAAAACTACGGGTCTTGCAATCTCAGGCGCAAAGTGCCGTTGGGCAAAAGCAAGCACTACAGGCTGC
TTCACAATTAGCCAGCAATCAATCACATCAATTACTTCAAATCAGAGGGCTTTTATTAGCACAACAAAAC
GCGCAGGCGGTAAAAGATGCGGCAAACGCCAATAAAGAGGCCATACAGGCCGCGGGTGATGAGCAATTTC
GAGCGGGTACGTATCATAAAAGTTCAGGTAAAAAATGGTAA
 Primer design