SecReT4
Protein ID: 296106094
T4SS name [ID]Trb [53]
Gene symboltrbL
Locus taglpa_00814
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]622980..624377 [+]
ProductConjugal transfer protein trbL
Component typeTrbL
UniProt IDD5T8V6
KEGG IDlpa:lpa_00814
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-33, Aligned region: 64..278
Protein Sequence: 465 a.a.     [Download]
>gi|296106094|ref|YP_003617794.1| Conjugal transfer protein trbL [Legionella pneumophila 2300/99 Alcoy]
MNKKTTTSLLILCLLGFSVCCHAQGHGIDSRDLLDNILYRFSSTASMWSQTILSYARYLFWSLATISMVW
TYGLMALRKADIQEFLAETVKFLVVVGFFYWILDNGPAIATAIMDSMRLLAAKASGINEHVSPSDIVDVG
FDIVSKAIDSSSIWSPAATTVGLIVAGLILIILALVSINMLIILITAWILTYGGIILLGFGGGRWTQDIA
INYYKTVLGIALQAFAMILIIGIGKSFVDQYYAAMSENIMLKEMFVMMVVAVLLLVLINKIPPVLSGIVS
GGGSGGGGGLGLGGALGAAGIAGTALAGAAGAAAVQSAGGLSALQAAFKAASHSIGASGAGSVSGDSPGS
KQGSLAQAMGQASKFAGSFGSHLASGAFDVAREKAASMKDAFSAKAADTTGGKIADAIHQRISSNAESPT
INQQVSESQNVTSMGAPEGSFSSCNINSDDEISQFVNQKASGDGQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|296105497|ref|NC_014125.1|:622980-624377 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAATAAAAAGACAACCACCTCTTTACTCATACTCTGTTTGCTAGGCTTTTCTGTATGCTGTCATGCCC
AGGGCCATGGTATAGACAGCAGAGATTTGCTAGACAATATCTTATATCGTTTTTCCAGCACTGCCTCGAT
GTGGAGCCAAACTATTTTAAGTTATGCTCGTTACCTTTTTTGGTCTTTGGCCACCATCAGCATGGTATGG
ACTTATGGTCTCATGGCTTTGCGAAAAGCAGACATTCAAGAGTTTTTGGCAGAAACCGTAAAATTTTTAG
TGGTTGTCGGTTTTTTCTATTGGATTTTAGATAATGGGCCTGCGATTGCAACTGCAATCATGGATTCTAT
GCGACTGCTCGCTGCAAAAGCTTCTGGAATTAACGAACATGTGTCGCCTTCTGACATTGTGGATGTGGGG
TTTGATATTGTATCAAAAGCAATCGACAGCTCATCAATCTGGTCACCGGCTGCAACGACGGTAGGATTAA
TTGTTGCTGGGCTTATTCTGATTATATTGGCGTTGGTCAGTATTAATATGCTCATTATCCTGATTACAGC
CTGGATCTTGACTTATGGTGGCATCATTTTATTAGGTTTTGGCGGCGGACGCTGGACACAGGATATTGCG
ATTAACTATTACAAAACAGTACTAGGGATCGCATTACAAGCCTTTGCCATGATTTTGATTATCGGCATAG
GAAAGTCTTTTGTAGATCAATATTATGCGGCAATGTCAGAAAACATCATGCTAAAAGAAATGTTTGTCAT
GATGGTTGTTGCCGTACTTTTGTTGGTACTTATCAATAAAATTCCCCCTGTTTTATCCGGCATCGTTTCA
GGTGGAGGATCAGGTGGCGGTGGTGGACTTGGTCTTGGAGGCGCGTTAGGGGCTGCGGGAATTGCAGGAA
CAGCCTTAGCAGGCGCTGCGGGTGCTGCAGCTGTGCAGAGTGCTGGGGGATTATCCGCTTTACAGGCTGC
ATTCAAGGCTGCTTCTCATAGTATCGGCGCAAGTGGCGCTGGCTCCGTGTCAGGAGATAGCCCAGGCTCA
AAACAAGGTAGTTTGGCTCAGGCCATGGGACAAGCTTCTAAATTTGCTGGTTCCTTTGGTTCACATTTAG
CTTCTGGGGCGTTTGATGTCGCCCGTGAAAAAGCAGCAAGCATGAAAGATGCTTTTTCTGCAAAAGCGGC
TGATACCACAGGCGGTAAAATTGCTGATGCCATTCATCAGCGCATATCTTCCAATGCTGAATCGCCAACT
ATTAATCAACAGGTATCCGAGTCTCAAAATGTCACTTCTATGGGTGCTCCAGAAGGCAGTTTTAGTTCAT
GTAACATAAACAGTGATGATGAGATCAGTCAATTTGTCAATCAAAAAGCATCTGGAGACGGTCAATGA
 Primer design