SecReT4
Protein ID: 296106095
T4SS name [ID]Trb [53]
Gene symboltraG
Locus taglpa_00815
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]624374..626263 [+]
ProductConjugal transfer protein traG
Component typeTraG
UniProt IDD5T8V7
KEGG IDlpa:lpa_00815
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.9e-134, Aligned region: 122..609
TraG-D_C [PF12696], Evalue: 5.7e-31, Aligned region: 439..563
TrwB_AAD_bind [PF10412], Evalue: 7.2e-26, Aligned region: 153..563
Protein Sequence: 629 a.a.     [Download]
>gi|296106095|ref|YP_003617795.1| Conjugal transfer protein traG [Legionella pneumophila 2300/99 Alcoy]
MSLNKPNKAIGPQVRQKHNEKTNKQLVILVALSLFISMQVGTQFVAYKLHFSDELGFSLNHVYFPWQSLW
WSLKYHHYYPDYFNAAFGLMAMSGSLFLMLIVFVAKHLKKENISEYLHGSARWANRDDLKNAGLFGNEEG
VYVGAIEDEKGDIHYLRHNGPEHILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKH
ANNKVIRFEPATLKGSARWNPLDEIRAGTEYEVGDVQNLATLVIDPDGKGLETHWQKTSQALLVGFILHA
IYKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHVDGKTHFVISASARDMIDRPEEEAGSVLSTL
KSYLALYRDPIVAYNVSASDFCIKDLMHHASPVSLYIVTQPNDKARLQPLVRVMLNMVVRLLADKMEFER
VDDGRGNYFVRTKKTYKHRLLCMIDEFPSLGKLDILQESLAFVAGYGLKFYLICQDINQLKSRERGYGPD
ETITSNCHIQNAYPPNRIETAEHLSKLTGQTTIVKEHTTTSGKRFSTFLNQISKTKQEVSRPLLTVDECQ
RMPGPKKDENGLIKEAGDMVVYVAGFPAIYGKQPLYFKDPVFIARASVEAPEQSDILRARLREDEEIRL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|296105497|ref|NC_014125.1|:624374-626263 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAGCTTGAATAAACCCAACAAAGCCATTGGCCCACAGGTGAGGCAAAAGCATAATGAAAAAACGAATA
AACAACTTGTTATTTTAGTTGCCCTCTCGCTTTTCATCAGTATGCAGGTTGGCACACAATTTGTGGCTTA
TAAGTTGCATTTTAGTGATGAATTAGGGTTTTCGCTGAATCATGTCTACTTTCCATGGCAGTCTCTTTGG
TGGAGCTTGAAATACCATCATTATTATCCTGATTATTTTAATGCAGCCTTTGGTTTGATGGCGATGAGTG
GCAGTCTTTTTTTAATGTTGATTGTTTTTGTTGCTAAGCATTTAAAAAAAGAAAACATCAGTGAATACCT
GCATGGTTCAGCCAGATGGGCCAACAGAGATGATTTAAAAAATGCTGGACTGTTTGGCAATGAGGAAGGC
GTTTATGTCGGTGCTATTGAAGATGAAAAAGGGGATATTCATTATTTACGCCATAATGGCCCAGAGCATA
TTTTAACTTATGCCCCAACGCGTTCTGGCAAAGGGGTTGGTCTTGTTATTCCTACCCTTTTATCCTGGAA
ACAGTCTTGTGTGATTACGGATTTAAAAGGAGAGCTTTGGGCATTAACAGCTGGTTGGCGTCAAAAGCAT
GCCAACAATAAAGTCATTCGCTTTGAGCCGGCAACATTAAAGGGTTCAGCCCGATGGAATCCATTAGATG
AAATTAGAGCAGGTACGGAATATGAAGTTGGTGATGTACAAAATCTTGCAACGCTTGTAATTGATCCTGA
TGGTAAAGGACTTGAAACCCACTGGCAGAAAACATCCCAAGCACTTTTGGTTGGGTTTATTCTACATGCA
ATTTATAAGCTGAAAAATCAAGGAGAACCGGCTACTTTTCCAAATATTGATCGCATGTTGGTCGATCCAA
ATACCAACATCGCCGATTTATTGATTGAAATGACTCAATACCCACATGTTGATGGCAAAACACATTTTGT
TATCAGCGCATCGGCTCGCGATATGATTGATAGGCCGGAGGAAGAAGCAGGTTCTGTCTTGTCCACCTTA
AAATCGTACCTGGCTTTATACCGTGATCCGATAGTTGCTTACAATGTCTCTGCATCAGATTTCTGTATTA
AAGATTTGATGCATCATGCAAGCCCTGTCAGTCTTTATATCGTGACCCAACCCAATGATAAAGCACGATT
ACAGCCTTTAGTTCGGGTTATGCTGAATATGGTTGTCCGCCTTTTGGCGGATAAAATGGAATTTGAACGA
GTCGATGATGGGCGAGGGAATTATTTCGTAAGAACGAAGAAAACCTATAAACATCGCCTGTTGTGCATGA
TTGATGAATTCCCAAGTCTTGGGAAGCTTGATATTTTACAAGAGTCATTGGCGTTTGTTGCCGGTTATGG
TTTGAAGTTTTATTTAATCTGCCAGGACATTAATCAACTTAAAAGTCGTGAGCGCGGCTATGGCCCAGAT
GAAACCATCACCTCGAACTGTCATATCCAAAATGCCTATCCGCCCAACCGAATTGAAACCGCCGAGCATC
TTTCAAAACTAACCGGCCAGACTACTATTGTAAAAGAGCATACCACTACTAGCGGTAAACGGTTTTCAAC
CTTTCTAAATCAGATTTCAAAAACAAAACAAGAAGTTTCTCGACCGCTTTTGACGGTTGATGAATGTCAA
CGTATGCCTGGACCAAAAAAAGATGAAAACGGTTTAATCAAGGAAGCAGGCGATATGGTGGTGTATGTGG
CAGGATTTCCTGCCATTTATGGCAAACAGCCGCTTTATTTTAAAGACCCTGTGTTTATCGCCAGAGCTTC
TGTTGAAGCGCCAGAGCAATCAGATATCTTACGCGCCCGCCTTCGTGAAGATGAGGAAATCAGACTATGA
 Primer design