SecReT4
Protein ID: 296106096
T4SS name [ID]Trb [53]
Gene symboltraF
Locus taglpa_00816
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]626260..626805 [+]
ProductPlasmid transfer protein traF precursor
Component typeTraF
UniProt IDD5T8V8
KEGG IDlpa:lpa_00816
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.8e-35, Aligned region: 27..173
Protein Sequence: 181 a.a.     [Download]
>gi|296106096|ref|YP_003617796.1| Plasmid transfer protein traF precursor [Legionella pneumophila 2300/99 Alcoy]
MKKFTSWIAVLMLSIIGMAFLFMLMGFRVNTTDSIPFGLYRITNIKNIKNAYVIFCPDDRPVFKQGLDRG
YIGSGLCPGGYGYLMKKVVATNGDQISITSDGVFVNRQLILFSKPTLIDGRKRPLPQWRTIDYQIKEDEL
ITMTSQSECSFDSRYYGPIRIGQIKGVIKPIWVNATSGEIA
 
Nucleotide Sequence: 546 bp     [Download]
>gi|296105497|ref|NC_014125.1|:626260-626805 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAAAAGTTCACTTCCTGGATTGCTGTTCTTATGTTAAGCATCATCGGCATGGCATTTCTTTTCATGC
TGATGGGCTTTCGCGTGAACACTACAGATTCCATTCCTTTTGGCCTTTATCGCATTACAAATATAAAAAA
CATCAAAAATGCCTATGTGATTTTTTGCCCTGATGATCGACCGGTTTTTAAACAGGGATTAGATAGAGGC
TATATCGGAAGTGGCCTTTGCCCTGGCGGTTATGGGTATTTAATGAAAAAAGTGGTGGCAACAAATGGTG
ATCAAATATCTATCACCTCCGACGGCGTTTTTGTTAATCGCCAACTTATTCTCTTTTCAAAACCGACATT
AATAGATGGAAGGAAACGACCTTTGCCTCAATGGCGCACCATAGATTATCAGATCAAAGAAGATGAACTC
ATAACCATGACTAGCCAAAGCGAATGCTCTTTTGATAGTCGTTATTATGGCCCTATTCGGATAGGGCAAA
TTAAGGGAGTAATTAAACCCATATGGGTAAATGCAACAAGTGGAGAAATAGCATGA
 Primer design