SecReT4
Protein ID: 296106584
T4SS name [ID]Tfc [752]
Gene symbol-
Locus taglpa_01505
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]1190004..1191371 [-]
Productmembrane protein, Tfp pilus assembly, pilus retraction ATPase PilT
Component typeTfc22
UniProt IDD5TBT3
KEGG IDlpa:lpa_01505
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|296106584|ref|YP_003618284.1| membrane protein, Tfp pilus assembly, pilus retraction ATPase PilT [Legionella pneumophila 2300/99 Alcoy]
MKKSLLLALLIPALTHAGSFMPSQSDYYYELGGTSNLFIPPVNKDQTLRIGADIDGRMGFSCSGFNPVVS
ITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPSLYNVLQNAASSAQNEFTLKVKDCQEVKQA
LEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKSIAQKRDEYGLPWIGHDKGNAGGKFQRPIKV
INDVVIAGYNVLLERKPLDSLEKPSTKIPMVQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGL
SALLQSCANANTCSQNIAKALWNLVNGTWTLTEENLHKVSASNLLITDEVITTIQHLPREEQMLTVSKLA
EEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETLGTI
MDIRHQAQSQNIPGQDHEQPAVKNGAIYVKENKGA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|296105497|ref|NC_014125.1|:c1191371-1190004 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAGAAATCTCTATTACTAGCTTTACTCATTCCAGCACTAACTCATGCTGGCAGCTTTATGCCTAGCC
AATCGGATTACTATTATGAATTAGGAGGAACATCCAATTTATTTATTCCACCCGTTAATAAAGATCAAAC
CCTGCGTATTGGCGCGGATATTGATGGCCGTATGGGATTTTCCTGTAGCGGTTTTAATCCTGTCGTGTCC
ATTACCAATACTTTTCAAGATTTGAAAAAATCAGCGTTAAATATCCCTGGTGGTGTCATTGATAACCTCA
AAGGTTCTGTCGCAGGATTCCCGCTTTATAAGCTGCAACAATCCATGCCTTCTTTATACAATGTTCTACA
AAACGCTGCATCCAGTGCACAAAATGAATTTACCCTCAAAGTTAAAGATTGTCAGGAAGTCAAACAAGCA
CTGGAACAAAACCAATCTCCAATGGAGGGTATATTATCAGTATCCGATAGTCAGGGATGGCTTGATGCTG
CCAAACGAGCTAAAAAAGAAAACGTCGATGTGACCGAGACATCGAAAAGCATCGCCCAAAAACGAGATGA
ATATGGCCTGCCCTGGATAGGCCACGATAAAGGCAATGCTGGCGGTAAATTTCAACGCCCAATTAAGGTA
ATTAATGATGTGGTCATTGCAGGCTACAACGTTCTTTTAGAGAGAAAACCTTTAGATTCTTTAGAGAAAC
CGAGTACCAAAATCCCTATGGTACAAAGCTGGCCAACCCCTACCGATGCTGCTAATTGGGCAGTTAAAGT
TCTTGGCGATATTCAAGTCAGCAGTAGTGAGAACAAACAAAGCCATGATGCTAAAGCAGGGATAGGTTTG
TCAGCTTTATTGCAAAGCTGTGCAAACGCCAATACTTGTAGCCAGAACATTGCCAAAGCCTTATGGAATT
TGGTCAATGGTACTTGGACATTGACTGAGGAAAATCTGCATAAAGTCAGTGCCTCCAATTTACTGATTAC
CGATGAAGTCATTACTACCATTCAGCATCTACCCCGTGAAGAACAAATGCTCACAGTCTCAAAACTGGCC
GAGGAAATCGCTGTTCAAAATATGTTGGATAAAGCGTTGATGATGCGCCGCATCTTACAGGCAGGATTAC
AAGTGCAAGAAGTACAGAATTTAAAACCTGCTATGAATATGGTCTTGTTTGCCTTGAAAAAATTGGACGA
TGACATTCACTCTTTGTCCTTTGAAAACGATGTCCGCAAAAAAATGATGACTGAAACCTTAGGAACCATC
ATGGATATTCGACATCAAGCCCAAAGCCAAAATATACCAGGCCAGGATCACGAACAACCTGCTGTTAAAA
ACGGGGCAATCTACGTCAAAGAAAATAAGGGAGCTTAA
 Primer design