SecReT4
Protein ID: 296106592
T4SS name [ID]Tfc [752]
Gene symbol-
Locus taglpa_01518
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]1198080..1198442 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDD5TBU1
KEGG IDlpa:lpa_01518
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.7e-09, Aligned region: 11..113
Protein Sequence: 120 a.a.     [Download]
>gi|296106592|ref|YP_003618292.1| hypothetical protein lpa_01518 [Legionella pneumophila 2300/99 Alcoy]
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIGFIFSITVWPK
GVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
 
Nucleotide Sequence: 363 bp     [Download]
>gi|296105497|ref|NC_014125.1|:c1198442-1198080 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAGTCAGCCTTCTTCGCGCCATCTATCACATGACTTTCCAGCCTGGAAAGGCTTAAGTCTGCGTGAAT
TGTTTTGGATTGTCATCACTACAACACCAGTAACTACCTTGCTTTTTATTCTTTTAGGAACAATGGCAGG
GTATCCACTAGCCGCTGGCTGCATCGGTTTTGTGATTGGATTCATCTTCTCCATTACCGTATGGCCAAAA
GGAGTCGCCCGTATCAAAGCAGGCAAACCTTATGGTTATGTGATGAAGAAAACCATTCAATGGATGGTGC
GATTAAGGCTCAAACACTCGCCCTGGATTCATTATCAGGGGCAGTGGCAAAAGAATAAATCTGTTGGAGA
GCCTCATGTTTGA
 Primer design