SecReT4
Protein ID: 296106595
T4SS name [ID]Tfc [752]
Gene symbol-
Locus taglpa_01522
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]1199082..1199408 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDD5TBU4
KEGG IDlpa:lpa_01522
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.8e-05, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|296106595|ref|YP_003618295.1| hypothetical protein lpa_01522 [Legionella pneumophila 2300/99 Alcoy]
MKRLLCLTLIMISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQVTPNARIQLQIEGFEDLQGQHHS
GLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|296105497|ref|NC_014125.1|:c1199408-1199082 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGAAACGATTGCTTTGTTTGACCTTGATAATGATAAGCCTTCAATGCTCAGCAAATAACCCTGATTTAA
ATGAAACTTTGGTGCGCATCATTAATCAGATTAACGCCATCATGCCTTTGCTTGATGAAGCGCAAACACA
AGTAACACCTAATGCTCGTATCCAATTGCAAATAGAAGGATTTGAAGACCTCCAAGGCCAGCATCACTCC
GGATTGAGAGAAGACTTGCTAAATATCCGCAACGGCCTGATTGACTACATCAACCAGCCCATCATTGCCC
CTCGAAAAATTAAACCATTAGAAATGGATTTTGTGAGGAAACCTTAA
 Primer design