SecReT4
Protein ID: 296106596
T4SS name [ID]Tfc [752]
Gene symbol-
Locus taglpa_01523
StrainLegionella pneumophila 2300/99 Alcoy
Repliconchromosome [GenBank: NC_014125] [Browse all T4SS(s) in this replicon]
Location [Strand]1199418..1200050 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDD5TBU5
KEGG IDlpa:lpa_01523
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.5e-43, Aligned region: 87..207
Protein Sequence: 210 a.a.     [Download]
>gi|296106596|ref|YP_003618296.1| hypothetical protein lpa_01523 [Legionella pneumophila 2300/99 Alcoy]
MAVKQYSRQLTMQLTIVLFLGWLAIIIWALSQWMLHGYPIAFEKVNILVNTQREAISPVYQGSLLAVLPL
NAKPDWALAIPYVNKLVINDLAKDLIEKSQQFLQILLLSSQCLLIKLIILFAALPLFALTMIAGLVDGLN
QRAIRTACLGRESSYVFHRLNHYLKKGLVILLMLWLALPVSITPAYVFVPISLLMGLMVAMTASRFKKYL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|296105497|ref|NC_014125.1|:c1200050-1199418 Legionella pneumophila 2300/99 Alcoy chromosome, complete genome
ATGGCAGTAAAGCAATATTCAAGGCAACTGACCATGCAATTAACCATAGTGCTATTCTTAGGTTGGTTAG
CAATTATTATCTGGGCATTGAGCCAATGGATGCTGCATGGCTACCCCATCGCTTTTGAAAAAGTGAATAT
CCTTGTAAACACTCAAAGAGAGGCTATTAGTCCTGTTTATCAAGGCTCCCTTCTGGCAGTCCTTCCTTTA
AATGCCAAACCAGATTGGGCATTAGCCATTCCTTACGTAAACAAATTGGTCATTAATGATCTTGCCAAGG
ATTTAATCGAAAAATCACAACAATTCTTGCAAATCCTTTTATTAAGCAGCCAGTGCCTTTTAATCAAACT
CATTATCTTATTCGCTGCCCTGCCCTTATTTGCTTTAACCATGATTGCAGGTCTGGTTGACGGACTAAAT
CAAAGAGCGATACGCACTGCTTGTTTAGGCCGTGAATCCTCTTATGTGTTTCACAGGCTTAATCACTATT
TAAAAAAGGGTCTTGTGATTTTACTTATGCTGTGGCTTGCCCTGCCCGTCAGCATCACCCCTGCTTATGT
TTTTGTTCCTATCAGTTTATTGATGGGGTTAATGGTAGCGATGACGGCCAGCCGTTTTAAGAAGTATTTA
TAG
 Primer design