SecReT4
Protein ID: 296136387
T4SS name [ID]Trb [264]
Gene symbol-
Locus tagTint_1936
StrainThiomonas intermedia K12
Repliconchromosome [GenBank: NC_014153] [Browse all T4SS(s) in this replicon]
Location [Strand]2075412..2076380 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD5X2G6
KEGG IDtin:Tint_1936
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.4e-45, Aligned region: 79..303
Protein Sequence: 322 a.a.     [Download]
>gi|296136387|ref|YP_003643629.1| conjugal transfer protein TrbG [Thiomonas intermedia K12]
MKLFPYALVALAMVARSAMAMPSTTTIHLIGTPDKGRTSDQLVHGVAPVPLSSRATEDASQEWLQTGIAP
SLVGTNGQVMYPYGQSRPTITCAPLHICVINLMAGEHITNMSIGDSVRWLVQSAGAGNRPVVVVKPTAAG
LVTNLVVTTDAGRVYYMTLVSDAHDYVPLVGFYDPQQLVINMQQQAAQAGAAEQARVEARKKAVVAPMGS
INPASLDFDFTCKADDGHADLENADLKPVRVFAGGGHTYVQMPPDMKYTDAPAVFNVTNGQTELMNSRLV
HGYYIIDGLPQRFKLVVGVGKGASSVTCRHGQPGGGGWFSGR
 
Nucleotide Sequence: 969 bp     [Download]
>gi|296134504|ref|NC_014153.1|:c2076380-2075412 Thiomonas intermedia K12 chromosome, complete genome
ATGAAACTCTTCCCCTACGCACTGGTGGCTCTCGCCATGGTGGCTAGATCCGCGATGGCCATGCCGAGCA
CGACGACGATTCACCTGATCGGTACCCCGGACAAGGGACGCACGAGCGACCAACTGGTCCATGGGGTCGC
TCCGGTCCCGCTCTCGTCGAGGGCGACGGAGGATGCCAGCCAGGAATGGCTGCAAACCGGGATCGCGCCT
TCTCTCGTCGGCACCAATGGCCAGGTCATGTACCCCTACGGCCAAAGTCGGCCCACGATCACCTGCGCAC
CACTGCACATTTGCGTCATCAACCTGATGGCGGGGGAGCACATCACCAACATGTCCATCGGCGACTCGGT
GCGCTGGCTCGTGCAATCGGCCGGCGCCGGCAATCGCCCCGTGGTGGTGGTCAAGCCCACGGCCGCCGGT
CTGGTGACCAACCTGGTGGTCACGACCGACGCCGGGCGGGTCTATTACATGACATTGGTGAGCGACGCCC
ATGACTACGTGCCGCTGGTCGGCTTCTACGACCCGCAGCAACTGGTGATCAACATGCAGCAGCAGGCCGC
GCAGGCGGGGGCGGCTGAGCAGGCCAGGGTCGAGGCCAGGAAGAAAGCCGTGGTTGCGCCCATGGGCAGC
ATCAACCCGGCAAGCCTGGACTTCGACTTCACCTGCAAGGCGGATGACGGCCATGCCGATCTTGAGAACG
CCGATCTGAAGCCCGTGCGCGTCTTCGCCGGGGGCGGCCACACTTATGTGCAGATGCCGCCTGACATGAA
ATACACCGACGCGCCAGCCGTGTTCAACGTCACCAACGGTCAGACGGAGCTGATGAACAGTCGCCTGGTG
CATGGCTACTACATCATCGATGGCTTGCCGCAGAGGTTCAAACTGGTCGTCGGCGTCGGCAAGGGCGCCA
GCAGCGTGACATGCCGGCACGGTCAGCCAGGTGGTGGCGGCTGGTTCTCTGGGCGGTGA
 Primer design