SecReT4
Protein ID: 296136410
T4SS name [ID]Trb [264]
Gene symbol-
Locus tagTint_1960
StrainThiomonas intermedia K12
Repliconchromosome [GenBank: NC_014153] [Browse all T4SS(s) in this replicon]
Location [Strand]2100350..2101333 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD5X2I9
KEGG IDtin:Tint_1960
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.5e-46, Aligned region: 83..312
Protein Sequence: 327 a.a.     [Download]
>gi|296136410|ref|YP_003643652.1| conjugal transfer protein TrbG [Thiomonas intermedia K12]
MTPTKSLLALAILAAAATAHAAPPAASASQPKPDIKPTTSIPLQTSHQIYDLKAPIPLSWRATTAAAQTW
LNTGSAPSMVGTNGMVMYAYGQSQPTITCAPLHICVINLLPGEHITNLSIGDSVRWLVQTADAGKTPVVV
VKPTAAGLTTNLAVTTDAGRVYYLTLVSDQHNYVPQIGFYDPQQLVINMEQQAAQQRAAEAAQTAAKQQA
VIAPLGHIDPSALDFNYTCKLDDGHADLENDDLLPLRVFSGGGHTYLQMPGKMRYTDAPAVFNVTSDTTE
LLNSRLVHDYFVIDGLPQKFKLVVGVGKCSRSVTCHHQQMNAGWWAR
 
Nucleotide Sequence: 984 bp     [Download]
>gi|296134504|ref|NC_014153.1|:c2101333-2100350 Thiomonas intermedia K12 chromosome, complete genome
ATGACTCCCACCAAATCCCTGCTCGCCCTGGCCATCCTGGCCGCCGCAGCCACCGCCCACGCCGCGCCAC
CGGCAGCCTCAGCCTCCCAACCCAAGCCCGACATCAAGCCCACGACATCGATCCCACTGCAAACCAGCCA
TCAGATCTACGACCTCAAGGCGCCGATCCCGCTGTCCTGGCGGGCGACCACGGCCGCAGCCCAGACCTGG
CTGAATACCGGCAGCGCCCCCAGCATGGTCGGCACCAACGGCATGGTGATGTATGCCTATGGCCAGAGCC
AGCCCACCATCACCTGCGCCCCGTTGCACATCTGCGTCATCAACCTGCTGCCCGGCGAGCACATCACCAA
CCTGTCCATCGGCGACAGCGTGCGCTGGCTGGTGCAGACCGCCGATGCCGGAAAGACGCCGGTCGTCGTA
GTCAAACCGACCGCCGCGGGCCTGACGACCAATCTGGCCGTCACCACCGATGCGGGCCGGGTGTACTACC
TGACGCTGGTCAGCGACCAGCACAACTATGTGCCGCAAATCGGCTTCTACGATCCGCAGCAGTTGGTCAT
CAACATGGAGCAGCAGGCCGCCCAACAGCGCGCCGCCGAAGCGGCGCAGACCGCCGCCAAGCAGCAGGCC
GTCATCGCCCCGCTGGGCCACATCGACCCCTCGGCGCTGGACTTCAACTACACCTGCAAACTCGACGACG
GCCACGCCGACCTGGAGAACGACGACCTGCTGCCGCTGCGCGTGTTCTCCGGCGGCGGCCACACCTATCT
GCAGATGCCGGGCAAGATGCGCTACACCGATGCGCCCGCCGTGTTCAACGTCACCAGCGACACCACCGAA
CTGCTCAACAGTCGCCTGGTGCACGACTACTTCGTCATCGACGGCCTGCCGCAGAAGTTCAAGCTGGTCG
TCGGCGTGGGTAAATGCTCGCGCAGCGTCACCTGCCATCACCAGCAGATGAACGCCGGCTGGTGGGCCCG
CTGA
 Primer design