SecReT4
Protein ID: 296136418
T4SS name [ID]Trb [264]
Gene symbol-
Locus tagTint_1968
StrainThiomonas intermedia K12
Repliconchromosome [GenBank: NC_014153] [Browse all T4SS(s) in this replicon]
Location [Strand]2104193..2105923 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDD5X2J7
KEGG IDtin:Tint_1968
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.8e-23, Aligned region: 114..339
Protein Sequence: 576 a.a.     [Download]
>gi|296136418|ref|YP_003643660.1| P-type conjugative transfer protein TrbL [Thiomonas intermedia K12]
MRTVTAATSRHALMRKRRAAPSFLIPLGGPDANAAGLGGLSIRVQWAVAAGLMLLLAVAATAHAAPAPTP
TGGPGGQGYLDTISSQFQAATTGWMTTAQGYAFKIFTALAAMDLSWWGIKQVLKKNDLADFIAGATLKIA
SIAFFYTIVKYAPTWMPLITSSFMDMGQAIGGSSAATASPSGVMSMAFSVVHQLYEVYNKAPGGLLNIGS
NLFLAIIIAITALLALIGFGLVALQLLMTLIETYLVGGAGLVMLGFTGSGLTSSFGEKYIGYLVSVGIKL
LMIYAIIGLGQNLINSELAYIAQYTGGKSLPPTDLLTVGVSMLIYGVIGMQAPGLAGSLMNGSPNMSLGN
VAGGAAAIAGGIVAAGVAGAAGYASAAKGLDRMAGLVGAGAGGGASGAGGAIAGAEKLAALGQATGAAGK
PAGGMAGSIGGGAKGGGGIGGTGAAAPSGKPAGALAAPGTAGGNTARLGQASQAMMEGKGISGPSSTPLK
PSAPSASPQPSPAPSAPPKGPVDALGAPSVESGSADLSKAASNSDREPFDVLKDNLGKVASTKDDIARHE
GGGGSGIQIRLGHVEH
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|296134504|ref|NC_014153.1|:c2105923-2104193 Thiomonas intermedia K12 chromosome, complete genome
ATGCGAACCGTCACCGCCGCAACGTCGCGCCATGCCCTCATGAGAAAACGCAGGGCCGCCCCAAGTTTTC
TCATCCCCCTTGGGGGGCCTGACGCGAACGCGGCAGGTCTGGGGGGCCTCTCAATCCGCGTGCAATGGGC
CGTCGCTGCGGGGTTGATGCTCTTGCTTGCGGTGGCGGCCACCGCCCACGCCGCCCCGGCGCCCACCCCG
ACGGGCGGCCCAGGGGGGCAGGGCTACCTCGACACCATCAGCTCCCAGTTTCAAGCCGCGACCACCGGCT
GGATGACCACGGCTCAGGGCTATGCCTTCAAGATTTTTACGGCGCTGGCCGCCATGGATCTGTCCTGGTG
GGGGATCAAGCAGGTGCTCAAGAAGAACGATCTGGCCGATTTCATTGCCGGGGCCACGCTGAAGATCGCC
TCCATCGCCTTTTTCTACACCATCGTCAAATACGCACCGACATGGATGCCGCTGATCACATCGAGCTTCA
TGGACATGGGGCAGGCCATCGGCGGTTCGAGCGCCGCAACAGCATCGCCCTCTGGCGTGATGTCGATGGC
CTTCTCCGTGGTGCATCAACTCTACGAGGTCTACAACAAGGCGCCGGGCGGTTTGTTGAACATCGGCAGC
AACCTGTTCCTGGCCATCATCATCGCCATCACCGCGCTGCTGGCCCTGATCGGCTTCGGCCTGGTTGCCT
TGCAGTTGTTGATGACGCTGATCGAGACCTATCTGGTCGGCGGCGCTGGCCTGGTGATGCTGGGCTTCAC
GGGCTCCGGCCTGACCAGCAGTTTTGGTGAGAAATACATCGGCTATCTGGTCAGCGTGGGCATCAAGCTG
TTGATGATCTACGCCATCATCGGCCTCGGGCAGAACCTCATCAACAGCGAACTCGCCTACATCGCGCAAT
ACACCGGAGGAAAGTCGCTGCCGCCCACCGATCTGCTGACGGTCGGCGTCAGCATGCTCATCTACGGGGT
CATCGGCATGCAGGCGCCGGGCCTGGCGGGCAGCCTGATGAACGGATCTCCCAATATGTCCCTGGGCAAC
GTCGCGGGCGGCGCTGCGGCGATCGCGGGCGGCATCGTCGCGGCGGGCGTGGCAGGGGCCGCAGGCTACG
CCAGCGCGGCCAAAGGCCTCGACAGAATGGCCGGGCTGGTCGGGGCCGGGGCGGGCGGCGGCGCCTCAGG
CGCGGGCGGCGCGATCGCCGGCGCAGAAAAACTCGCCGCCCTCGGCCAGGCCACTGGCGCAGCGGGCAAA
CCCGCAGGCGGCATGGCGGGTTCCATCGGCGGTGGCGCGAAAGGAGGCGGCGGCATCGGCGGGACTGGCG
CTGCTGCGCCCTCTGGCAAGCCCGCCGGAGCCTTGGCCGCGCCTGGCACAGCCGGAGGCAATACCGCCCG
CTTGGGCCAGGCGTCGCAGGCCATGATGGAAGGCAAGGGCATCAGCGGCCCTTCAAGCACGCCGCTGAAG
CCCTCTGCGCCCAGCGCATCGCCACAACCCTCACCCGCGCCGAGCGCCCCGCCGAAAGGCCCGGTCGATG
CCCTGGGCGCACCCTCCGTCGAGAGTGGATCGGCCGATCTGAGCAAGGCGGCGAGCAACTCGGATCGAGA
GCCGTTCGACGTGCTGAAAGACAACCTCGGCAAGGTGGCCAGCACCAAAGACGATATTGCCCGGCATGAG
GGCGGGGGCGGCAGCGGCATTCAGATCCGCCTCGGCCATGTGGAGCACTGA
 Primer design