SecReT4
Protein ID: 296136424
T4SS name [ID]Trb [264]
Gene symbol-
Locus tagTint_1974
StrainThiomonas intermedia K12
Repliconchromosome [GenBank: NC_014153] [Browse all T4SS(s) in this replicon]
Location [Strand]2110979..2111332 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDD5X2K3
KEGG IDtin:Tint_1974
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-15, Aligned region: 19..106
Protein Sequence: 117 a.a.     [Download]
>gi|296136424|ref|YP_003643666.1| conjugal transfer protein Trbc [Thiomonas intermedia K12]
MKRLKLLSIHHRLRAAVVRRLVLASAVFAATMADAFATGAGGLPWDSAVSTLQNDLTGPVATAISVIAFL
AAGAALVFGEELGGIAKKALYVVLGVAFIVLGNKFLQVLGLTGALVF
 
Nucleotide Sequence: 354 bp     [Download]
>gi|296134504|ref|NC_014153.1|:c2111332-2110979 Thiomonas intermedia K12 chromosome, complete genome
ATGAAACGTCTCAAACTGCTTTCCATCCATCACCGCCTGCGCGCCGCCGTCGTGCGCCGCCTGGTTCTGG
CCTCCGCCGTATTCGCCGCCACCATGGCCGACGCCTTCGCCACCGGCGCCGGCGGCCTGCCGTGGGACAG
CGCGGTCAGCACCCTGCAGAACGACCTGACCGGCCCGGTGGCCACGGCCATCAGCGTCATCGCCTTTCTG
GCGGCGGGCGCCGCCCTGGTGTTCGGCGAAGAACTCGGCGGCATCGCCAAGAAAGCGCTGTATGTGGTGC
TCGGCGTGGCGTTCATCGTCCTGGGCAACAAATTCCTCCAGGTGCTCGGACTGACCGGCGCCCTGGTGTT
CTGA
 Primer design