SecReT4
Protein ID: 297622191
T4SS name [ID]Trw [149]
Gene symbol-
Locus tagpKOX105p12
StrainKlebsiella oxytoca KOX105 plasmid pKOX105 (NC_014208)
Repliconplasmid pKOX105 [GenBank: NC_014208] [Browse all T4SS(s) in this replicon]
Location [Strand]9689..10453 [+]
ProductTraC
Component typeTrwJ
UniProt IDD7RTW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.1e-49, Aligned region: 42..233
CENP-Q [PF13094], Evalue: 3.8e-06, Aligned region: 50..154
Protein Sequence: 254 a.a.     [Download]
>gi|297622191|ref|YP_003675742.1| TraC [Klebsiella oxytoca KOX105]
MAQRILAPDGLTTRQNTMKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKS
QLQTQKNMYESMAKTTNLGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMT
PSEAITYMNKKLAEKGAYDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGE
QAKLNLMNMLQQSQDKLLRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 765 bp     [Download]
>gi|297622181|ref|NC_014208.1|:9689-10453 Klebsiella oxytoca KOX105 plasmid pKOX105, complete sequence
ATGGCTCAAAGAATACTGGCGCCTGACGGCTTAACAACGAGGCAAAACACCATGAAAAAAACACTGACGG
CAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCGCAGGCATCATCGTGACCAA
CCCTACTGAGCTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCAGCTGGAGCAGCTTAAAAGC
CAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAACCTGGGCGATCTGCTGGGGA
CGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATCTACAGCGACGCCATGAACTC
CAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGCGGAAGTTGACGACATGACG
CCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCTTATGACCGCGTTATGGCAG
AAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGACGGAGCAGATTAAAACGAC
TCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACAGGGTGCTATTCAGGGTGAG
CAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTATTACGTGCGCAGAAAGAAC
GTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCACCTTCAATTAACTGA
 Primer design