SecReT4
Protein ID: 297622193
T4SS name [ID]Trw [149]
Gene symbol-
Locus tagpKOX105p15
StrainKlebsiella oxytoca KOX105 plasmid pKOX105 (NC_014208)
Repliconplasmid pKOX105 [GenBank: NC_014208] [Browse all T4SS(s) in this replicon]
Location [Strand]11963..12661 [+]
ProductTraE
Component typeTrwG
UniProt IDD7RTX2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-53, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|297622193|ref|YP_003675745.1| TraE [Klebsiella oxytoca KOX105]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSK
FKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|297622181|ref|NC_014208.1|:11963-12661 Klebsiella oxytoca KOX105 plasmid pKOX105, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTGGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAACGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGACCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTAGCAACGATACGCTTTACTACGGTTCGCCGCGTGCGCAGCAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCTGAAGTTAACTGA
 Primer design