SecReT4
Protein ID: 297622195
T4SS name [ID]Trw [149]
Gene symbol-
Locus tagpKOX105p17
StrainKlebsiella oxytoca KOX105 plasmid pKOX105 (NC_014208)
Repliconplasmid pKOX105 [GenBank: NC_014208] [Browse all T4SS(s) in this replicon]
Location [Strand]13556..14716 [+]
ProductTraF
Component typeTrwE
UniProt IDD7RTX4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-54, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|297622195|ref|YP_003675747.1| TraF [Klebsiella oxytoca KOX105]
MARKSVDVDQELDENTGDGEFESERGGFKGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRTPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTAARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGVQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDTHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGEQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|297622181|ref|NC_014208.1|:13556-14716 Klebsiella oxytoca KOX105 plasmid pKOX105, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAAAGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCACCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGCCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGTGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGCAATGACCAGGACGGGACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATACCCATATGT
GGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGCACAGAAAACAGCGGTGAGCAGCTGGCGTCTGAAGCACTTCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design