SecReT4
Protein ID: 298206445
T4SS name [ID]Tra_F [530]
Gene symboltraL
Locus tagETEC1392/75_p1018_029
StrainEscherichia coli ETEC 1392/75 plasmid p1081 (NC_014232)
Repliconplasmid p1081 [GenBank: NC_014232] [Browse all T4SS(s) in this replicon]
Location [Strand]14786..15097 [+]
Productputative TraL conjugal transfer pilus assembly protein
Component typeTraL_F
UniProt IDD7GK59
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|298206445|ref|YP_003717547.1| putative TraL conjugal transfer pilus assembly protein [Escherichia coli ETEC 1392/75]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|298206425|ref|NC_014232.1|:14786-15097 Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCAAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design