SecReT4
Protein ID: 298503702
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12200
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2011739..2011960 [+]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDD6ZP82
KEGG IDsnc:HMPREF0837_12200
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|298503702|ref|YP_003725642.1| hypothetical protein HMPREF0837_12200 [Streptococcus pneumoniae TCH8431/19A]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVKDILLELFNRI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2011739-2011960 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
ATGAATTTTGGACAAAACCTTTATAACTGGTTTCTATCAAACGCTCAATCACTGGTGCTTTTAGCAATCG
TTGTGATTGGCTTGTATCTTGGCTTCAAGCGTGAGTTTAGCAAACTGATTGGCTTTTTAATTATTGCGAT
TATTGCGGTTGGCTTAGTCTTCAACGCTGCTGGAGTAAAAGACATTTTACTAGAGCTATTCAATCGCATT
ATTGGTGCTTAA
 Primer design