SecReT4
Protein ID: 298503704
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12202
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2012549..2013055 [+]
Productconjugative transposon membrane protein
Component typeOrf17_Tn
UniProt IDD6ZP84
KEGG IDsnc:HMPREF0837_12202
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 2.6e-34, Aligned region: 44..145
Protein Sequence: 168 a.a.     [Download]
>gi|298503704|ref|YP_003725644.1| conjugative transposon membrane protein [Streptococcus pneumoniae TCH8431/19A]
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSINDFRLPFPITFT
QMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTY
AGKKVTLGRNQPQEAITAVRSEFYGISN
 
Nucleotide Sequence: 507 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2012549-2013055 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
ATGGGATTTTTGAAATCGTCTATTAAATCTGTCGGTACATTACTACTGGCAGATTTTCTATTTTACGGGG
TGGCTCAATCAGCTACCCCTATTTTTTATGAAAGGATTGATTACATGAAGAAAATACGAAGCTATACCAG
TATCTGGTCTGTGGAAAAGGTACTGTATTCTATCAATGATTTTAGACTTCCGTTTCCCATAACCTTTACG
CAAATGACATGGTTTGTCGTGTCACTCTTTGCAGTGATGATACTTGGCAACTTGCCCCCTCTTTCCATGA
TAGAGGGAGCATTTCTCAAATACTTTGGGATTCCTGTGGCTTTCACATGGTTTATGTCTACAAAAACTTT
TGATGGTAAAAAGCCTTATGGATTTTTGAAGTCTGTCATTGCTTATGCACTGCGACCAAAGCTGACCTAT
GCAGGAAAAAAAGTAACGCTTGGCAGAAACCAGCCACAAGAAGCCATTACAGCAGTTAGGAGTGAATTTT
ATGGCATATCCAATTAA
 Primer design