SecReT4
Protein ID: 298503705
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12203
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2013039..2015486 [+]
Productconjugative transposon protein
Component typeOrf16_Tn
UniProt IDD6ZP85
KEGG IDsnc:HMPREF0837_12203
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-33, Aligned region: 468..763
Protein Sequence: 815 a.a.     [Download]
>gi|298503705|ref|YP_003725645.1| conjugative transposon protein [Streptococcus pneumoniae TCH8431/19A]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYH
LSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYK
LSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVL
YGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGIS
SRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSIS
LEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2013039-2015486 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
ATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGT
TCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGA
CGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCAT
CTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTT
TGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTAC
CATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTT
ACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCA
ATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCATGGCAAAGTGATAATGAAACCAGCTCTAATGT
GGCGGAAGCTCTGGAAAGTGTGAACGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTATAAG
CTGTCCTATGTTGTAAGGGTATCAGCAAATGACCTTGACGAACTTAAACGTCGTTGTAATGAAGTGAAAG
ATTTCTATGATGATTTGAGCGTGAAACTGGTACGACCTTTTGGGGATATGCTGGGCTTACATGAAGAATT
TTTACCTGCCAGCAAAAGATATATGAATGACTATATTCAATACGTGACCTCTGATTTCCTCGCTGGTTTA
GGTTTTGGTGCTACTCAAATGCTGGGTGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGATACTGGAC
GCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTC
TGCCTTTGTCGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCAGTGCTT
TATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTGCCAGAGA
TTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACCCTTATGT
GATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGGGATTTCC
TCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAAGTACGAG
GGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCGACCATAT
CGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTCTATCAGC
TTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCCTTTGAGG
AATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGTAGCACAA
GGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTCGTGACCC
AAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTCGTTCCAC
TGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAATCAGAAG
CGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGT
TCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGGTGTAA
 Primer design