SecReT4
Protein ID: 298503706
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12204
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2015489..2017666 [+]
Productconjugative transposon membrane protein
Component typeOrf15_Tn
UniProt IDD6ZP86
KEGG IDsnc:HMPREF0837_12204
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 725 a.a.     [Download]
>gi|298503706|ref|YP_003725646.1| conjugative transposon membrane protein [Streptococcus pneumoniae TCH8431/19A]
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYSRYPLENYQLD
FYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQT
LAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKK
INDFSSDISNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLL
STSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFII
YAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQS
GSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKV
KENVRDLTSSISQTKAERASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTS
KQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQ
RVPLQNTRSRPPIKTATIKKVGKKP
 
Nucleotide Sequence: 2178 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2015489-2017666 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
GTGAAACCATCAATAGTAAACAGAATAAAATCAAACTGGACGCTGAAACGTCTAGGTAAAGTGGCAATGA
CAGTGGCTTTCACACTTGTGATTGCCATTTTTCTTTTAGCCATGCTGGGAACGGTGGTTCAAGCTGCGGG
CTTGGTAGATGATACGGTCAATGTGGCAAATGAATACAGCCGATACCCACTTGAAAACTATCAACTGGAT
TTTTATGTGGATAATAGCTGGGGCTGGCTTCCGTGGAACTGGTCGGACGGGATTGGAAAACAGGTCATGT
ATGGACTATATGCCATTACCAATTTTATTTGGACAATCAGTTTGTATGTTTCCAATGCGACAGGTTACTT
AGTACAGGAAGCCTATTCCTTAGACTTCATTTCCGCTACAGCAGATTCCATTGGTAAGAATATGCAGACC
TTAGCTGGTGTGAGTGCAAACGGATTTTCAACAGAGGGTTTCTATGTTGGATTCCTCTTACTCTTGATTT
TGGTTCTTGGGGTTTATGTTGCCTATACGGGACTGATAAAGAGAGAAACCACAAAGGCAATTCATGCCAT
TATGAATTTTGTGCTGGTGTTTATCCTATCGGCTTCCTTTATTGCCTACGCTCCCGACTACATTAAAAAA
ATCAATGACTTTTCATCAGACATCAGTAATGCCAGTTTATCACTTGGCACGAAGATTGTCATGCCCCATT
CCGATAGTCAAGGCAAGGACAGCGTGGACTTAATCAGAGATAGCCTGTTTTCCATACAGGTTCAGCAACC
GTGGCTACTGCTTCAATACAACAGTTCAGACATTGAAAGTATCGGTATTGACCGTGTGGAAAGCCTGCTC
TCCACCAGCCCAGATTCCAACAATGGCGAAGACAGAGAAAAAATTGTTGCGGAAGAAATTGAAGACAGAA
GCAATACCAATCTAACCATTACAAAGACCATTAACCGTTTAGGTACAGTCTTCTTCCTATTTGTCTTCAA
TATTGGGATTTCCATATTTGTATTCCTATTAACAGGAATCATGATTTTCTCGCAGGTACTTTTTATCATC
TATGCTATGTTTCTGCCTGTGAGCTTTATTTTAAGCATGATTCCATCATTTGATGGTATGTCAAAACGAG
CCATAACAAAGCTCTTTAATACCATTTTGACACGAGCTGGAATCACATTGATTATTACGACAGCATTTAG
TATTTCAACCATGCTCTATACCTTATCGGCTGGTTATCCGTTCTTTTTGATTGCTTTTCTACAGATTGTG
ACCTTTGCAGGAATCTACTTCAAGCTGGGCGATTTAATGAGTATGTTTTCTCTACAGAGTAACGATTCTC
AAAGTGTGGGAAGTCGTGTGATGAGAAAACCTCGTATGCTTATGCACGCTCACATGCACCGTCTACAGCG
GAAACTTGGACGTTCCATGACTACTCTAGGGGCTGGGTCTGCCATTGTTACAGGTAAAAAAGGACAGTCG
GGTTCGGGGAGTTCTGCAAGGACACAAGCAGATCACTCCCGACCAGACGGAAAGGAAAAATCAACACTTG
GAAAACGTATCGGTCAAACCATCGGTACAGTAGCTGATACCAAAGACAGAATGGTAGACACTGCTAGTGG
TTTGAAAGAACAGGTTAAAGATTTGCCGACCAATGCAAGATATGCAGTATATCAAGGAAAATCCAAAGTA
AAAGAGAATGTCCGTGATTTAACCAGTAGTATTTCTCAAACCAAAGCGGAAAGAGCCAGTGGACGCAAGG
AACAGCAGGAACAAAGGCGAAAAACCATTGCGAAGCGTCGCTCTGAAATGGAACAGGTCAAACAGAAAAA
ACAGCCTGCTTCTTCTGTTCATGAAAGACCGACTACAAGACAAGAACAATATCATGATGAACAGACCTCA
AAACAGTCTAATATTCAGACTTCATATAAGGAATCTCAACAAGCCAAACAAGAGCGTCCAGCAGTTAAGT
CCGATTTTTCAAGTCCAAAAGTGGAACGCCAAGGCAATACCGTTCAAGAAAAAACCGTTCAAAAGCCAGC
AACTTCAACCACTACAGCAGATAGAACTTCACAACGTCCAATCACAAAAGAACGTCCGTCTACTGTTCAA
AGAGTACCACTACAAAATACAAGAAGTAGACCACCAATCAAAACCGCCACCATTAAGAAAGTCGGTAAGA
AACCATGA
 Primer design