SecReT4
Protein ID: 298503707
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12205
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2017663..2018664 [+]
ProductNLP/P60 family protein
Component typeOrf14_Tn
UniProt IDD6ZP87
KEGG IDsnc:HMPREF0837_12205
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 8.1e-61, Aligned region: 46..202
NLPC_P60 [PF00877], Evalue: 1.2e-31, Aligned region: 224..329
Protein Sequence: 333 a.a.     [Download]
>gi|298503707|ref|YP_003725647.1| NLP/P60 family protein [Streptococcus pneumoniae TCH8431/19A]
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKYAKEYGVEEYV
NILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGG
GFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDD
TVQAIMDEALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLV
FFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2017663-2018664 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
ATGAAGTTGAAAACTTTAGTGATTGGTGGTTCTGGATTATTCTTGATGGTCTTCTCACTGCTTCTGTTTG
TTGCCATTTTATTTTCAGATGAACAGGACAGCGGAATTTCCAATATTCATTATGGAGGTGTGAATGTTTC
CGCAGAAGTGCTGGCTCATAAGCCTATGGTAGAAAAATATGCCAAAGAATATGGCGTTGAAGAATATGTC
AACATACTTCTTGCGATTATACAGGTGGAATCGGGCGGTACTGCGGAAGATGTTATGCAGTCCTCGGAAT
CCCTCGGTCTTCCACCTAATTCATTGAGTACAGAAGAATCCATTAAGCAAGGTGTGAAGTATTTCAGTGA
ATTATTAGCCAGTAGCGAAAGGCTCAGTGTAGATTTAGAATCGGTTATCCAGTCCTACAATTATGGTGGT
GGTTTCTTAGGGTATGTGGCTAATCGTGGAAATAAATATACCTTTGAACTGGCTCAAAGTTTCTCAAAAG
AGTATTCAGGTGGCGAAAAAGTGTCTTACCCCAATCCCATAGCCATACCTATCAATGGGGGCTGGCGATA
CAACTATGGCAATATGTTTTATGTGCAACTGGTAACGCAGTATCTTGTCACAACAGAGTTTGATGATGAT
ACGGTACAAGCCATCATGGACGAAGCACTGAAATATGAGGGCTGGCGATACGTTTACGGTGGAGCTTCCC
CGACTACTTCTTTTGATTGTAGCGGACTGACACAATGGACGTATGGAAAAGCTGGAATTAACTTACCACG
AACCGCACAACAGCAATATGATGTGACCCAGCATATCCCACTATCGGAAGCACAAGCTGGCGATTTGGTT
TTCTTTCATTCTACCTATAACGCTGGCTCTTATATTACTCATGTTGGGATATACCTTGGCAATAACCGTA
TGTTTCATGCAGGCGACCCAATCGGTTATGCCGACTTAACAAGCCCCTACTGGCAACAGCATTTAGTGGG
AGCAGGACGAATCAAACAATGA
 Primer design