SecReT4
Protein ID: 298503708
T4SS name [ID]Tra_Tn [649]
Gene symbol-
Locus tagHMPREF0837_12206
StrainStreptococcus pneumoniae TCH8431/19A
Repliconchromosome [GenBank: NC_014251] [Browse all T4SS(s) in this replicon]
Location [Strand]2018661..2019593 [+]
Productconjugative transposon protein
Component typeOrf13_Tn
UniProt IDD6ZP88
KEGG IDsnc:HMPREF0837_12206
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1e-62, Aligned region: 83..309
Protein Sequence: 310 a.a.     [Download]
>gi|298503708|ref|YP_003725648.1| conjugative transposon protein [Streptococcus pneumoniae TCH8431/19A]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTI
IEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQI
WTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIES
EGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTV
EYIDQQTKATQVSQFDLVLEKNGSNWKIIE
 
Nucleotide Sequence: 933 bp     [Download]
>gi|298501502|ref|NC_014251.1|:2018661-2019593 Streptococcus pneumoniae TCH8431/19A chromosome, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGGGCT
TAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACTATC
ATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACTATT
CATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGAACT
TCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAGATA
TGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAGAGG
GAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATATGGT
ACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAAAGT
GAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCTATC
CTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGAGTA
CATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACAGTG
GAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACGGGA
GTAATTGGAAGATTATAGAATAA
 Primer design