SecReT4
Protein ID: 298736034
T4SS name [ID]VirB [609]
Gene symbolvirD4
Locus tagHPB8_538
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]510833..512962 [-]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDD7FD38
KEGG IDhpl:HPB8_538
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3e-65, Aligned region: 95..612
TraG-D_C [PF12696], Evalue: 2.9e-22, Aligned region: 458..578
TrwB_AAD_bind [PF10412], Evalue: 2.8e-20, Aligned region: 420..594
AAA_10 [PF12846], Evalue: 1.9e-05, Aligned region: 148..532
Protein Sequence: 709 a.a.     [Download]
>gi|298736034|ref|YP_003728559.1| type IV secretion system protein VirD4 [Helicobacter pylori B8]
MKMQFVKAFCVLFSILLIPLFFILANYYTFDALKSLRQAYFFSQSVFVGLYHGASIFDLKFEVYLTMLIS
LMPFVATIYINFPKTTETSHGYARWANVKDIECFKIFSKEGFCKVVHRLGVQFDNGFILGKFGFPKLRNV
CYDKPLGAMIVAPPGAGKTACVALPNLLTLPNSCIITDIKGELRDKTAGYRQKFLNNRILIFNPYGDDNT
CYFNPFDKRIVEKMTFAEQLRHVKAVGDGIFVDEEDHWVSKAKELFVFFALLQVVTKGHSSFYDVSIAPA
NDYAPLIHPKSPYYKQLYQHDKKTGEVILDPQTNAPMKNPQANVLKLFLNQVADQKYIDMNDEKNYDPRE
PEPPYGTKGALDEIIRTDARSWANTPDDEFGSIMSSFKRFMYVYKDPKVREATSKMSFDYEELRTGNISI
YIVIAQIDIGTLSSLVRAFLESIAKNLMVKESSKPEERIFIIADEFVRFGKLPFLLEMPALCRSYNVVPL
FITQDYAMIRKYYSDDDLKILKGVVHYNIVFKMNSAEDAEIVSKEVGEFTRQSKNYSTEKGQLVFGGSSS
YSHEGRNLLTAQDIMNINSDEVIVIVTGAKATPLKLKANYWFKDKELLKRANLPIDLEVERQRVEEPIQP
TTPQELENSNLKESEKDNESPITLENANENIEQGNHNEIDEILKKPLSEISMEEKRALFKKMQQGDEESE
QEVTQSTQS
 
Nucleotide Sequence: 2130 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c512962-510833 Helicobacter pylori B8 chromosome, complete genome
ATGAAAATGCAATTTGTGAAGGCTTTTTGCGTGCTTTTTAGCATTTTACTTATCCCCTTATTTTTTATCT
TGGCAAATTATTACACTTTTGATGCCTTAAAGTCGTTGAGACAGGCTTATTTCTTTTCTCAAAGCGTGTT
TGTAGGGCTTTATCATGGGGCAAGCATCTTTGATTTAAAATTTGAAGTCTATCTTACTATGCTAATCTCT
TTAATGCCCTTTGTGGCTACGATTTATATCAATTTCCCAAAAACCACAGAAACTTCGCATGGCTATGCGA
GATGGGCTAATGTTAAAGATATAGAATGCTTTAAAATTTTTAGCAAAGAGGGCTTTTGTAAAGTGGTGCA
TAGATTAGGGGTGCAATTTGATAATGGCTTTATTCTAGGTAAATTTGGTTTTCCAAAGCTTAGAAATGTG
TGCTATGACAAGCCCTTAGGAGCGATGATTGTTGCGCCCCCTGGTGCTGGAAAAACTGCATGTGTGGCTT
TGCCAAATTTATTGACTTTGCCTAATAGCTGTATTATCACTGATATTAAAGGCGAACTAAGAGATAAGAC
CGCAGGTTATAGACAAAAATTCTTAAACAATAGAATTTTAATTTTTAATCCTTATGGTGATGATAACACT
TGCTATTTCAATCCTTTTGATAAAAGGATTGTTGAAAAGATGACCTTTGCGGAGCAATTAAGGCATGTTA
AAGCAGTAGGCGATGGTATTTTTGTAGATGAAGAAGACCATTGGGTATCTAAAGCTAAAGAGCTTTTTGT
CTTTTTTGCTCTTTTACAAGTAGTAACCAAAGGGCATAGCTCTTTTTATGATGTCTCTATCGCACCAGCT
AATGATTATGCCCCCTTAATACACCCTAAAAGCCCTTATTACAAGCAACTTTACCAACACGATAAAAAGA
CAGGCGAAGTTATCTTAGACCCACAAACTAACGCCCCCATGAAAAATCCCCAAGCTAATGTTTTAAAACT
CTTTTTAAATCAAGTGGCTGACCAAAAATACATAGATATGAATGATGAAAAAAACTATGACCCAAGAGAA
CCTGAACCCCCTTATGGAACAAAAGGGGCGTTAGATGAGATTATAAGGACAGATGCTAGGAGTTGGGCAA
ACACTCCTGATGATGAATTTGGGAGCATTATGTCTTCTTTTAAGCGTTTTATGTATGTCTATAAAGACCC
AAAAGTGCGTGAAGCTACTTCTAAAATGAGCTTTGATTATGAAGAATTAAGAACGGGCAATATCAGTATT
TACATTGTAATCGCTCAAATTGATATAGGCACACTTTCTTCTTTAGTAAGAGCCTTTTTAGAGAGTATTG
CTAAAAACCTTATGGTCAAAGAAAGCTCTAAACCTGAAGAGCGTATTTTTATCATTGCTGATGAATTTGT
TAGATTTGGTAAGTTGCCTTTCTTGTTAGAAATGCCAGCACTTTGTCGCTCTTATAATGTTGTCCCCTTA
TTCATCACGCAAGATTATGCGATGATTAGAAAATACTATAGCGATGATGATTTGAAAATCTTAAAAGGCG
TGGTGCATTATAACATTGTCTTTAAGATGAATAGTGCTGAAGATGCTGAGATTGTCTCTAAGGAAGTGGG
CGAATTTACAAGACAATCTAAAAATTATTCTACCGAAAAAGGTCAATTGGTCTTTGGAGGTAGCTCTTCT
TATAGCCATGAGGGTAGAAACTTACTCACAGCCCAAGATATTATGAATATCAATTCAGATGAAGTCATTG
TTATTGTTACAGGGGCTAAAGCTACCCCCTTAAAACTCAAAGCTAATTATTGGTTCAAAGATAAAGAGCT
TTTAAAAAGAGCTAATTTGCCTATTGATTTAGAAGTAGAGAGACAAAGAGTTGAAGAGCCTATACAACCC
ACTACACCACAAGAGCTTGAAAATTCAAACTTAAAAGAAAGCGAGAAAGACAATGAAAGTCCCATTACCT
TAGAAAATGCTAATGAAAATATAGAGCAAGGAAATCACAATGAAATTGATGAGATTTTAAAAAAGCCACT
GAGTGAAATCAGTATGGAAGAGAAAAGAGCCTTGTTTAAGAAAATGCAACAAGGCGATGAAGAAAGCGAA
CAAGAAGTTACACAAAGCACCCAAAGTTAA
 Primer design