SecReT4
Protein ID: 298736036
T4SS name [ID]VirB [609]
Gene symbolvirB11-3
Locus tagHPB8_540
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]513474..514418 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDD7FD40
KEGG IDhpl:HPB8_540
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.2e-44, Aligned region: 24..291
FtsK_SpoIIIE [PF01580], Evalue: 9.8e-05, Aligned region: 143..165
Protein Sequence: 314 a.a.     [Download]
>gi|298736036|ref|YP_003728561.1| type IV secretion system protein VirB11 [Helicobacter pylori B8]
MDLDKLKDYRALRNAILRLLPYLDSGITELIMNKEKEIWLYKLNGVREKVFDENLDKAFILGFGEQLASF
RDLFFNANYPTLNTSIPTSRYRVSMNHFAISADNELSLNIRVPSDKKFDLKAFKLSSTCQYDYEYLKNLM
IEGKNLLISGGTGSGKTSFLNALIEFIPKHTRIISVEDSEELDLRAFENHKSLLVDKTESSKFTYENALN
MAMRMSPDRLMVGEIDTRNSMLFLRFGNTGHKGMVSTLHADSVHGVIEAIALNLQMNKSGLDVNVAKKFF
KSSVDIVVQIVLDKATNTRYIQEILPAKDLRDSL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c514418-513474 Helicobacter pylori B8 chromosome, complete genome
ATGGACTTAGACAAACTCAAAGATTATAGGGCTTTAAGAAACGCTATTTTAAGGCTATTGCCTTATTTAG
ATAGCGGTATTACAGAGCTAATTATGAATAAAGAAAAAGAAATTTGGCTCTATAAGCTTAATGGAGTAAG
AGAAAAAGTCTTTGATGAAAATTTAGACAAAGCCTTTATTCTGGGGTTTGGGGAACAATTAGCGAGTTTT
AGAGATTTGTTTTTTAATGCTAATTATCCCACCCTTAATACCTCCATTCCTACTTCTAGATACAGAGTGA
GCATGAACCACTTTGCTATTAGTGCGGATAATGAATTGAGTTTGAATATTAGAGTGCCAAGTGATAAAAA
GTTTGATTTAAAAGCTTTCAAGCTTTCTAGTACCTGTCAATACGATTATGAGTATTTAAAAAACTTAATG
ATTGAGGGCAAAAACTTACTCATTAGTGGAGGCACAGGCAGTGGAAAAACGAGTTTTTTAAACGCTCTAA
TTGAGTTTATCCCTAAACACACACGAATAATAAGCGTTGAAGATAGCGAAGAATTAGATTTAAGAGCGTT
TGAAAATCATAAATCCTTGTTAGTGGATAAAACTGAAAGCTCTAAATTTACCTATGAAAACGCCTTGAAT
ATGGCAATGAGAATGTCTCCTGATAGGCTTATGGTAGGCGAGATTGACACACGAAATTCCATGCTCTTTT
TAAGATTTGGAAACACTGGGCATAAAGGCATGGTTTCTACTTTACATGCAGATAGTGTGCATGGGGTTAT
AGAGGCGATTGCTTTAAATTTACAAATGAATAAAAGTGGTTTAGATGTCAATGTAGCAAAAAAATTCTTT
AAAAGCAGTGTGGATATTGTCGTTCAAATTGTATTAGATAAAGCCACTAACACCAGATACATTCAAGAAA
TCTTACCAGCAAAAGATTTAAGAGATAGCCTATGA
 Primer design