SecReT4
Protein ID: 298736042
T4SS name [ID]VirB [609]
Gene symbolvirB8-1
Locus tagHPB8_546
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]520771..521907 [-]
Productputative VirB8 protein
Component typeVirB8
UniProt IDD7FD46
KEGG IDhpl:HPB8_546
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-25, Aligned region: 134..333
Protein Sequence: 378 a.a.     [Download]
>gi|298736042|ref|YP_003728567.1| putative VirB8 protein [Helicobacter pylori B8]
MSNLQELREHLKELENSFEIGSFTKENIKEYAKCFFMSLSMFLEEQEKNQQEEFLEQDTKENQEELIKSI
QTSIAKNQELEKISFEKWENKIQERVLPKLKRIVTHKLQESITSSINTQLESFKKDELDLSSVFEIQRKN
TQIAYRLAIGGLMGIIALSIAIFIMMPLKENTPYFIDFANSDKHFAVVQRADTKVDYDEAFLRNLVGSYI
TARETINHIDDKIRLNETIREQSSEEVWKTLEQLVSGKGSIYSNSNMDREIKIINISIYKQGKQQNIAVA
DIVAKVFDKGYLISEKRYRVSLIYHFKPLIQFDYSSMPKNPTGFIVDKYSLSEIASIKALDKTYKKVERP
HSKIEYKKQNPTNPQNNPANMPNNKEEQ
 
Nucleotide Sequence: 1137 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c521907-520771 Helicobacter pylori B8 chromosome, complete genome
ATGTCTAATTTGCAAGAACTTAGAGAGCATTTAAAAGAATTAGAAAATTCCTTTGAAATAGGCTCTTTTA
CTAAAGAAAATATTAAAGAATACGCTAAATGCTTTTTTATGAGTTTAAGCATGTTTTTAGAAGAACAAGA
AAAAAACCAACAAGAAGAGTTTTTAGAACAAGATACCAAAGAAAATCAAGAAGAGCTCATTAAAAGCATT
CAAACAAGCATTGCTAAAAACCAAGAGTTAGAAAAAATCTCTTTTGAAAAATGGGAGAATAAAATTCAAG
AAAGGGTTTTGCCTAAGTTAAAACGCATTGTTACGCATAAGTTGCAAGAAAGTATCACATCTAGCATAAA
CACGCAATTAGAGAGTTTTAAAAAAGATGAGTTAGATTTATCTAGCGTGTTTGAAATCCAAAGAAAGAAC
ACTCAAATAGCGTATAGATTAGCTATAGGGGGGCTTATGGGTATCATTGCTTTAAGTATAGCCATTTTTA
TTATGATGCCCTTAAAAGAAAACACGCCTTATTTTATAGACTTTGCTAATAGCGATAAGCATTTTGCTGT
GGTGCAAAGAGCGGATACCAAAGTAGATTATGACGAGGCATTTTTAAGAAATCTAGTCGGCTCTTACATT
ACAGCTAGAGAAACTATCAATCATATTGATGACAAAATCCGCTTGAATGAAACCATAAGAGAGCAAAGCT
CTGAAGAAGTGTGGAAAACTTTAGAGCAGTTAGTATCAGGCAAGGGCAGTATCTATTCTAACTCTAATAT
GGATAGAGAAATTAAAATCATCAATATTTCTATCTATAAGCAAGGCAAACAACAAAATATCGCTGTAGCA
GATATTGTAGCTAAGGTCTTTGATAAAGGCTATTTAATCTCTGAAAAACGCTACAGAGTGTCTTTAATCT
ATCACTTCAAACCCCTTATTCAATTTGATTATAGTTCTATGCCTAAAAACCCTACAGGCTTTATCGTAGA
TAAATATTCCTTGAGTGAAATCGCAAGCATTAAAGCCCTAGATAAGACTTATAAAAAAGTGGAAAGACCC
CATTCTAAAATTGAATACAAAAAACAAAATCCAACTAACCCCCAAAACAACCCAGCTAATATGCCTAATA
ATAAGGAAGAACAATGA
 Primer design