SecReT4
Protein ID: 298736193
T4SS name [ID]Cag [34]
Gene symbolcagD
Locus tagHPB8_698
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]671340..671984 [+]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDD7FDJ8
KEGG IDhpl:HPB8_698
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 214 a.a.     [Download]
>gi|298736193|ref|YP_003728719.1| cag pathogenicity island protein D [Helicobacter pylori B8]
MEELAKLINNNNSNKKLRGFFLKVLLSLVVFSSYGSANDDKEAKKEALEKEKNTPNGLVYTNLDFDSFKA
TIKNLKDKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINPEV
KDFFTFKSISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTITCE
AVYL
 
Nucleotide Sequence: 645 bp     [Download]
>gi|298735500|ref|NC_014256.1|:671340-671984 Helicobacter pylori B8 chromosome, complete genome
GTGGAGGAGCTAGCTAAATTGATCAACAATAATAATAGCAATAAAAAACTAAGAGGCTTTTTTTTGAAAG
TTCTCTTAAGTCTCGTTGTTTTCAGTTCGTATGGGTCAGCAAATGACGATAAAGAAGCCAAAAAAGAAGC
ACTAGAAAAAGAAAAAAACACTCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTTAAAGCG
ACTATCAAAAATTTGAAAGACAAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAG
TTTTTGACTTCGTGATTGTCAATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAATCAT
TGAAAAAATCTTTGATGAAAAGGGTAAAGAAATGGGATTGAATGTAGAATTACAGATCAATCCTGAAGTG
AAAGACTTTTTTACTTTCAAAAGCATCAGCACGACCAACAAACAACGCTGCTTTCTGTCATTGCGCGGAG
AAACAAGAGAAATTTTATGCGATGATAAGCTGTATAATGTTTTATTGGCCGTATTCAATTCTTATGATCC
TAACGATCTTTTGAAACATATTAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACAATTACATGTGAA
GCGGTATATCTATAA
 Primer design