SecReT4
Protein ID: 298736196
T4SS name [ID]Cag [34]
Gene symbolcagG
Locus tagHPB8_701
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]675807..676235 [+]
Productcag pathogenicity island protein G
Component typeCagG
UniProt IDD7FDK1
KEGG IDhpl:HPB8_701
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|298736196|ref|YP_003728722.1| cag pathogenicity island protein G [Helicobacter pylori B8]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPLG
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|298735500|ref|NC_014256.1|:675807-676235 Helicobacter pylori B8 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACTGATATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAGAATGTTAATATCAAATTTGACGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGTTATGCACCAACATACTCAGATTCATCGTTTTTACCACCATTAGGA
GGGTATTAA
 Primer design