SecReT4
Protein ID: 298736199
T4SS name [ID]Cag [34]
Gene symbolcagL
Locus tagHPB8_704
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]678502..679215 [+]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDD7FDK4
KEGG IDhpl:HPB8_704
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|298736199|ref|YP_003728725.1| cag pathogenicity island protein L [Helicobacter pylori B8]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDNTYQETNQQVLKNLDEIFSTTSPSANNKIGQEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQKTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKTYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEK
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|298735500|ref|NC_014256.1|:678502-679215 Helicobacter pylori B8 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTCTTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTTGATAACACCTACCAAGAGACCAACCAACAAGTGCTCAAAAACCTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATAATAAAATAGGTCAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTTAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAAGACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAGATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGACATATC
AGAGCAACATTGGAGGTACAGCTTCCTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAAAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGAAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGGCAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTCAAATGA
 Primer design