SecReT4
Protein ID: 298736200
T4SS name [ID]Cag [34]
Gene symbolcagN
Locus tagHPB8_705
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]679297..680223 [-]
Productcag pathogenicity island protein N
Component typeCagN
UniProt IDD7FDK5
KEGG IDhpl:HPB8_705
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 308 a.a.     [Download]
>gi|298736200|ref|YP_003728726.1| cag pathogenicity island protein N [Helicobacter pylori B8]
MILKSIFKKLGSVALYSLVVYGGLNAINTALLPSEYKKLVALGFKKIKTLYQRHDDEEITKEEKEFATNA
LREKLRNDRARAEQIQKNIEAFEKKNNSSIQKKAAKHKGLQELNEINANPLNDNPNSNSSTETKSNKDDN
FDEMINKVNEAFVKPAAPLVPNEWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEI
ETENNKFSRQHLSGLKLALNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNTSEFGATDTKENEAKDA
TFSNNHSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 927 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c680223-679297 Helicobacter pylori B8 chromosome, complete genome
ATGATCTTGAAAAGTATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTCTTTAGTTGTTTATGGGGGCT
TAAACGCTATCAATACAGCATTATTGCCGAGTGAATACAAAAAATTAGTGGCTTTAGGCTTTAAAAAAAT
CAAAACACTCTATCAAAGACATGACGACGAAGAAATTACAAAAGAGGAAAAAGAATTCGCCACTAACGCT
TTGAGAGAAAAATTACGAAATGATAGGGCGAGAGCAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAA
AAAAGAACAACTCTTCTATTCAAAAAAAAGCGGCTAAGCACAAAGGATTGCAAGAATTAAACGAAATTAA
CGCTAACCCTTTGAATGACAACCCTAATAGCAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAAC
TTTGATGAGATGATTAATAAGGTGAATGAAGCTTTTGTAAAACCTGCTGCTCCGCTTGTGCCTAATGAGT
GGAGAACACCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTACGATGGGTTAAG
AAAGTGTTTGATCAAAGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATA
GAGACAGAAAATAACAAGTTTTCTAGACAACACTTGAGTGGTTTAAAACTCGCTCTTAATAACAGCAACA
ATAGAACCTTTCTTATAGCTTCGTGCGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAA
CTACCAAGATACTACAAATACAAGTGAGTTTGGGGCTACTGATACAAAAGAAAACGAAGCAAAAGATGCA
ACATTCTCAAACAATCACTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCG
CTCATGGAAAAAAATAG
 Primer design