SecReT4
Protein ID: 298736201
T4SS name [ID]Cag [34]
Gene symbolcagM
Locus tagHPB8_706
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]680232..681362 [-]
Productcag pathogenicity island protein M
Component typeCagM
UniProt IDD7FDK6
KEGG IDhpl:HPB8_706
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|298736201|ref|YP_003728727.1| cag pathogenicity island protein M [Helicobacter pylori B8]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYRKLLPNPYAYVLNQETFT
KEDRERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKSV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c681362-680232 Helicobacter pylori B8 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTATGGATCATAGAGCTAAAGTTCTTTCAGACTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATTTGGAGCAAGCCTTAAA
AGATAACCCTCTCTATAGGAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAGGGAGCGTTTGAGTTATTACTACCCCCAGGTGAAAACGAGCAGTATTTTTAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTCTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAGTTTGACTCCA
AAGCAAAAGATATTGCTCAAAAGGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATTAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAGTGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAATTTTACCAATCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design