SecReT4
Protein ID: 298736206
T4SS name [ID]Cag [34]
Gene symbolcagT
Locus tagHPB8_711
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]684180..685022 [-]
Productcag pathogenicity island protein T
Component typeCagT
UniProt IDD7FDL1
KEGG IDhpl:HPB8_711
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|298736206|ref|YP_003728732.1| cag pathogenicity island protein T [Helicobacter pylori B8]
MKMRASVLIGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNNKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c685022-684180 Helicobacter pylori B8 chromosome, complete genome
ATGAAAATGAGAGCAAGTGTTTTAATCGGTGCGACAATTCTGTGCTTAATTTTAAGCGCATGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGATTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCACCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATCCTCCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCTGA
CATTGATTTTTACTTGCAACCCACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCCAACAACAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAGACTCTCTTGCAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAAGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design